SecReT4
Protein ID: 119384223
T4SS name [ID]Trb [332]
Gene symbol-
Locus tagPden_1483
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T4SS(s) in this replicon]
Location [Strand]1444645..1444977 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1B239
KEGG IDpde:Pden_1483
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.4e-24, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|119384223|ref|YP_915279.1| unnamed protein product [Paracoccus denitrificans PD1222]
MIRHALRIRQHIATAAAATYVSLFIAPAAHASGSSMPWEAPLQSILDSVEGPVAKIVAVIIIIVTGLTLA
FGDTGGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|119382757|ref|NC_008686.1|:c1444977-1444645 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGATCCGTCACGCCCTGCGCATCCGCCAGCACATCGCCACCGCGGCCGCCGCCACCTATGTCAGCCTGT
TCATCGCTCCGGCTGCGCATGCCTCCGGGTCTTCCATGCCCTGGGAAGCGCCTCTGCAATCCATCCTCGA
CTCCGTCGAGGGGCCGGTGGCCAAGATCGTGGCGGTGATCATCATCATCGTCACCGGTCTGACGCTGGCC
TTCGGCGATACCGGCGGCGGATTCCGGCGCCTGATCCAGATCGTGTTCGGCATCTCCATCGCCTTTGCGG
CCTCGTCCTTCTTCCTGAGCTTCTTCAGCTTCGGTGGCGGAGCGCTGATCTGA
 Primer design