SecReT4
Protein ID: 119385905
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3183
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]350279..350881 [+]
Productconjugal transfer protein precursor
Component typeTraF
UniProt IDA1B6X0
KEGG IDpde:Pden_3183
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.7e-52, Aligned region: 32..168
Protein Sequence: 200 a.a.     [Download]
>gi|119385905|ref|YP_916960.1| unnamed protein product [Paracoccus denitrificans PD1222]
MIRRTRTTYLAATAAAVMVIGAVSVTDITPRLIWNASASLPIGLYRVEPPTTLTLGDLVAVDPPEPLAQF
VTARGYVGPGVPLLKRVAALPGTRVCRTGATITVQGEAIGEARERDRIGRPLPTWQGCQVVGTDEVFLMN
REVGDSLDGRYFGPLPLASVTARIVPLWIDAAGDGRFRRPVAGTEGGSQNLSPTATEETK
 
Nucleotide Sequence: 603 bp     [Download]
>gi|119385557|ref|NC_008687.1|:350279-350881 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGATCCGCAGAACGCGCACCACCTATCTCGCCGCAACTGCTGCCGCCGTGATGGTGATCGGTGCTGTTT
CCGTCACCGACATCACGCCGCGGCTGATCTGGAACGCCAGCGCCAGCCTGCCCATCGGCCTCTACCGCGT
CGAACCGCCGACCACGCTCACCCTTGGCGATCTGGTCGCGGTCGATCCGCCCGAACCACTCGCCCAGTTC
GTCACCGCGCGCGGCTATGTCGGCCCCGGCGTGCCGCTGCTGAAGCGCGTCGCCGCCCTTCCCGGCACGC
GGGTCTGCCGCACCGGCGCCACGATCACCGTCCAGGGTGAGGCCATCGGTGAAGCGCGCGAGCGCGACAG
AATCGGCCGGCCGCTGCCCACCTGGCAGGGCTGCCAGGTCGTCGGCACGGACGAGGTGTTTCTCATGAAC
CGGGAGGTCGGGGACAGCCTCGACGGCCGTTATTTCGGTCCGCTCCCGCTCGCCAGCGTCACCGCCCGCA
TCGTCCCGCTCTGGATCGATGCGGCGGGCGACGGCCGCTTCCGCCGGCCTGTGGCCGGCACGGAAGGCGG
CTCCCAGAACCTCTCTCCAACCGCAACCGAAGAGACCAAATGA
 Primer design