SecReT4
Protein ID: 119385907
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3185
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]351220..352026 [+]
Productlytic transglycosylase, catalytic
Component typeTrbN
UniProt IDA1B6X2
KEGG IDpde:Pden_3185
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 268 a.a.     [Download]
>gi|119385907|ref|YP_916962.1| unnamed protein product [Paracoccus denitrificans PD1222]
MPVSVKHRAGGQACAARQAAILLLSGLTFAAVPAAVPLAQTVQPDVQEASDPFAAHVADASLRFGIPAHW
IRAVRHVESRGNPQAVSPKGAMGLMQVMPETWAALRARHALGSDPFDPRDNILAGAAYLREMHDRYGSIA
GMLAAYNAGPGRYDEHLVSGRALPAETRAYVAALAPMLGGEPLSGMSFAAAPPRDWREAPLFIGSPDAER
VQPGGLFVRRSDAEPAQSDGALAADPEPPAEPSDTAQSARAPQSDGLFVRRSDAGAVQ
 
Nucleotide Sequence: 807 bp     [Download]
>gi|119385557|ref|NC_008687.1|:351220-352026 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGCCGGTATCCGTCAAACACCGTGCCGGCGGGCAGGCCTGCGCCGCCCGCCAGGCCGCAATCCTTCTTC
TTTCCGGCTTGACATTCGCCGCCGTCCCGGCTGCCGTCCCGCTGGCGCAGACCGTGCAACCGGACGTGCA
GGAAGCCAGCGATCCCTTCGCCGCCCATGTCGCGGATGCCTCGCTGCGCTTTGGCATTCCGGCGCACTGG
ATCCGTGCCGTGCGCCATGTCGAAAGCCGCGGCAATCCGCAGGCCGTCTCGCCCAAGGGCGCCATGGGCC
TGATGCAGGTGATGCCGGAGACCTGGGCGGCGCTGCGCGCCCGCCATGCTCTCGGCAGCGATCCGTTTGA
CCCGCGCGACAACATCCTCGCCGGTGCCGCCTATCTGCGCGAGATGCACGACCGCTACGGCAGCATCGCC
GGCATGCTGGCGGCCTACAATGCCGGGCCGGGGCGCTACGACGAGCATCTGGTCTCGGGCCGGGCCCTGC
CGGCCGAGACCCGCGCCTATGTCGCCGCGCTGGCACCGATGCTCGGCGGCGAGCCGCTTTCCGGCATGAG
CTTCGCTGCTGCGCCACCGCGCGACTGGCGCGAGGCACCGCTGTTCATCGGCAGCCCGGATGCGGAACGA
GTGCAGCCCGGCGGTCTGTTCGTGCGCCGGTCCGATGCAGAACCTGCGCAGTCCGATGGCGCATTGGCTG
CCGATCCGGAACCGCCTGCCGAGCCGTCTGACACCGCTCAAAGCGCCCGCGCGCCGCAATCCGATGGCCT
GTTCGTCCGCCGGTCGGACGCAGGAGCTGTGCAATGA
 Primer design