SecReT4
Protein ID: 119385910
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3188
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]354719..356728 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA1B6X5
KEGG IDpde:Pden_3188
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.2e-103, Aligned region: 111..554
TraG-D_C [PF12696], Evalue: 5.1e-31, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 7.5e-31, Aligned region: 172..536
AAA_10 [PF12846], Evalue: 5e-07, Aligned region: 370..478
Protein Sequence: 669 a.a.     [Download]
>gi|119385910|ref|YP_916965.1| unnamed protein product [Paracoccus denitrificans PD1222]
MSGTKILWGQIAVVFLIVLISVWSGTQWAAWRLGFQPQLGPAWFELWGIPIYYPPALFWWWYFYDAYAPR
IFAEGGVIAASGGFLAIGVAITLSVMRAREAADVDTYGSARWAARPEIERAGLLGPDGVVLGKLGEDYLR
HDGPEHVLCFAPTRSGKGVGLVVPTLLTWPGSTIVHDIKGENWQLTAGFRARHGRVLLFDPTNAASAAYN
PLQEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGVILHVLYAEEDKTLARVAAFLSDPR
RSIEATLAAMMKTPHLGEAGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAQVTSRCDWRI
ADLIAAEKPSTLYLVVPPSDISRTKPLIRLVLNQIGRRLTEDLHAKDRGHRVLMLLDEFPALGRLDFFES
ALAFMAGYGLKAFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYA
GHRLAPWLGHIMVSRSETARPLLTPGEVMQLPPEDEIVMVAGTPPIRARKARYYTDPRFRERMLSPPDPR
EAVPSARADDWTGLTPPKPDGLVEKTDVKKEEGRAKRQDKANSGLRREPELPEHVEIVHERKEPSPEDEF
RHLLGDDQEDAVRQRQALRRKMAGVARQTSMDPGDDIPM
 
Nucleotide Sequence: 2010 bp     [Download]
>gi|119385557|ref|NC_008687.1|:354719-356728 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGTCCGGCACGAAGATCCTCTGGGGCCAGATCGCCGTGGTTTTCCTGATCGTGCTGATCTCGGTCTGGT
CGGGCACGCAATGGGCGGCCTGGCGGCTCGGCTTCCAGCCCCAGCTCGGCCCGGCCTGGTTCGAACTCTG
GGGTATCCCGATCTATTACCCGCCCGCCCTGTTCTGGTGGTGGTACTTTTACGACGCCTATGCCCCGCGC
ATCTTTGCCGAGGGCGGCGTCATCGCCGCCTCGGGCGGGTTTCTCGCCATCGGTGTCGCCATCACCCTGT
CGGTGATGCGCGCCCGCGAGGCCGCCGATGTCGACACCTACGGCTCGGCGCGTTGGGCAGCGCGGCCGGA
GATCGAGCGGGCGGGGCTGCTCGGCCCCGACGGCGTGGTGCTGGGCAAGCTGGGCGAGGACTACCTGCGC
CATGACGGGCCGGAGCATGTGCTTTGCTTCGCGCCGACGCGCTCCGGCAAGGGCGTTGGGCTGGTGGTGC
CGACGCTGCTGACCTGGCCGGGCTCGACCATCGTCCACGACATCAAGGGCGAGAACTGGCAGCTCACCGC
AGGGTTCAGGGCCAGGCATGGCCGGGTATTGCTCTTTGATCCGACCAATGCGGCCTCCGCTGCCTACAAT
CCCCTGCAGGAGGTGCGGCGCGGCGAATGGGAGGTGCGCGACGTCCAGAACATCGCCGATATCCTGGTCG
ATCCCGAGGGCTCGCTGGAAAAGCGCAACCATTGGGAAAAGACCAGCCACGCCCTGCTGGTCGGCGTCAT
CCTGCATGTGCTCTATGCCGAGGAGGACAAGACCCTGGCGCGCGTCGCCGCCTTCCTCTCCGACCCGCGC
CGCTCGATCGAGGCGACGCTGGCGGCGATGATGAAGACCCCGCATCTCGGCGAGGCCGGCCCGCATCCGG
TCATCGCCAGCGCCGCGCGGGAACTGCTGAACAAATCCGAGAACGAACGCTCAGGCGTGCTGTCCACCGC
CATGTCCTTCCTCGGCCTCTATCGCGACCCCGTCGTCGCCCAGGTCACCAGCCGCTGCGACTGGCGTATC
GCCGATCTGATCGCGGCGGAAAAACCCTCGACGCTTTACCTGGTGGTCCCGCCCTCGGATATCTCGCGCA
CCAAGCCGCTGATCCGGCTGGTGCTGAACCAGATCGGCCGCAGGCTGACCGAGGATCTGCATGCGAAGGA
CCGCGGGCACCGGGTGCTGATGCTGCTCGACGAATTCCCGGCGCTGGGGCGGCTGGACTTCTTCGAATCC
GCCCTGGCCTTCATGGCCGGCTATGGGCTGAAGGCTTTCCTGATCGCGCAGTCGCTGAACCAGATCGAAA
AGGCCTATGGCCCCAACAATTCGATCCTCGACAACTGCCATGTCCGGGTCAGCTTCGCCACCAACGACGA
GCGCACCGCCAAGCGGGTCTCGGACGCCCTCGGCACCGCCACCGAGATGAAGGCGATGAAGAACTATGCC
GGGCACCGGCTGGCGCCCTGGCTCGGGCATATCATGGTCTCGCGCTCCGAGACCGCGCGGCCGCTGCTCA
CCCCGGGCGAGGTGATGCAGCTGCCGCCCGAAGACGAGATCGTCATGGTGGCCGGCACCCCGCCGATCCG
GGCCAGGAAGGCGCGCTACTATACCGATCCGCGTTTCCGCGAGCGGATGCTGTCCCCGCCGGATCCGCGC
GAGGCTGTGCCGTCGGCGCGGGCGGACGACTGGACCGGGCTGACGCCGCCGAAGCCGGATGGTTTGGTCG
AAAAAACGGACGTCAAAAAAGAAGAGGGCAGGGCGAAGCGCCAGGACAAGGCCAATTCCGGCCTGCGCCG
CGAGCCGGAACTGCCCGAGCATGTCGAGATCGTCCACGAGAGGAAGGAACCATCGCCGGAGGACGAGTTC
AGGCATCTGCTCGGCGACGATCAGGAGGATGCGGTCCGGCAACGCCAGGCCCTGCGCCGCAAGATGGCTG
GTGTTGCCCGGCAGACCTCGATGGATCCCGGCGACGACATCCCGATGTGA
 Primer design