SecReT4
Protein ID: 119385916
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3194
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]359010..360014 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA1B6Y1
KEGG IDpde:Pden_3194
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-87, Aligned region: 25..290
TrwB_AAD_bind [PF10412], Evalue: 3.3e-05, Aligned region: 149..184
DEAD [PF00270], Evalue: 6.6e-05, Aligned region: 135..189
Protein Sequence: 334 a.a.     [Download]
>gi|119385916|ref|YP_916971.1| unnamed protein product [Paracoccus denitrificans PD1222]
MAGSDHIEARVERGARMLRTALGPAISALLRDPDIVEVMLNPDGRIWVDRLRDGLADTNQVLSASDGERI
IRLVAHHVGAEVHAHNPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAVAVFNLDDYVDTGIMTRMQAE
ALRLAVATRANILVSGGTSTGKTTLTNALLAEVAKTQDRVVIIEDTRELQCAAPNLVAMRTTDGVATLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSGIGALRRLEQLIQEAVITVPRALIA
ETVDIVAVLSGRGSARRLAELVRVEGLGPDGDYRIASVISDTDTYIAEKAGEPE
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|119385557|ref|NC_008687.1|:359010-360014 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGGCAGGTTCGGACCACATCGAGGCAAGGGTGGAGCGCGGTGCCCGCATGCTCCGCACCGCGCTCGGAC
CTGCCATCTCCGCCCTTTTGCGGGATCCCGACATCGTCGAGGTTATGCTGAACCCGGACGGCCGGATCTG
GGTGGATCGGCTGCGCGACGGGCTCGCCGATACCAACCAAGTCCTGTCCGCATCCGACGGCGAGCGTATC
ATCCGGCTGGTCGCGCATCACGTCGGCGCCGAGGTCCATGCGCACAATCCCCGCGTCTCGGCTGAGCTGC
CGGAAACGGGAGAACGCTTCGAGGGGCTGCTGCCGCCGGTCGTCGCCGCGCCCGCCTTCGCCATCCGCAA
GCCCGCCGTCGCCGTCTTCAACCTCGACGATTATGTCGACACCGGCATCATGACCCGGATGCAGGCCGAG
GCGTTGCGTCTCGCAGTCGCGACCCGCGCCAATATCCTCGTCTCGGGCGGCACCTCCACCGGCAAGACCA
CGCTGACCAATGCGCTGCTGGCCGAGGTGGCAAAGACGCAGGATCGCGTGGTCATCATCGAGGACACCCG
CGAGCTGCAATGCGCCGCGCCCAATCTGGTGGCGATGCGCACCACGGACGGCGTCGCCACCTTGTCCGAT
CTGGTGCGCTCCTCGCTGCGGCTGCGTCCCGACCGCATCCCCATCGGCGAGGTGCGCGGCGCCGAGGCGC
TCGACCTCCTGAAAGCCTGGGGCACCGGCCATCCGGGCGGCATCGGCACCATCCATGCCGGATCCGGCAT
CGGCGCCCTGCGCCGCCTCGAACAGTTGATCCAGGAAGCCGTGATCACCGTGCCCCGTGCCCTGATCGCC
GAGACCGTGGATATCGTCGCCGTTCTGTCCGGACGCGGGTCCGCGCGGCGGCTGGCCGAACTGGTCCGCG
TCGAGGGCCTCGGCCCGGACGGCGACTACCGCATCGCTTCCGTCATTTCCGATACCGACACGTATATCGC
AGAAAAAGCTGGAGAACCCGAATGA
 Primer design