SecReT4
Protein ID: 119385917
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3195
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]360011..360343 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA1B6Y2
KEGG IDpde:Pden_3195
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-24, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|119385917|ref|YP_916972.1| unnamed protein product [Paracoccus denitrificans PD1222]
MIRHALRIRHHVATAATTLYVSLFMAPAAHAAGSSMPWEAPLQSILDSVEGPVAKIVAVIIIIVTGLTLA
FGDTGGGFRRLIQIVFGISIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 333 bp     [Download]
>gi|119385557|ref|NC_008687.1|:360011-360343 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGATCCGTCATGCCCTGCGCATCCGTCATCACGTCGCGACGGCAGCGACCACACTCTATGTCAGCCTGT
TCATGGCTCCGGCGGCCCATGCCGCCGGTTCTTCCATGCCCTGGGAGGCGCCGCTGCAATCGATCCTCGA
TTCCGTCGAGGGGCCGGTGGCGAAGATCGTCGCGGTGATCATCATCATCGTGACCGGGTTGACGCTGGCC
TTCGGCGATACCGGCGGCGGCTTTCGTCGGCTGATCCAGATCGTCTTCGGCATCTCCATCGCCTTCGCGG
CCAGTTCCTTCTTCCTGTCCTTCTTCAGCTTCGGCGGCGGAGCGCTGGTGTAA
 Primer design