SecReT4
Protein ID: 119385918
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3196
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]360343..360624 [+]
Productconjugal transfer protein TrbB
Component typeTrbD
UniProt IDA1B6Y3
KEGG IDpde:Pden_3196
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1e-10, Aligned region: 16..85
Protein Sequence: 93 a.a.     [Download]
>gi|119385918|ref|YP_916973.1| unnamed protein product [Paracoccus denitrificans PD1222]
MSAGFEQLSEVPGFSVPVHRALNEPILLGGAPRSIAILNGTLAGAVGLGLQLWLAGILIWAVGHLATVWA
AKRDPLFVEVGRRHLRLPGHLAV
 
Nucleotide Sequence: 282 bp     [Download]
>gi|119385557|ref|NC_008687.1|:360343-360624 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGTCCGCAGGTTTCGAGCAGCTTTCCGAGGTTCCGGGCTTTTCGGTCCCGGTGCATCGCGCCCTGAACG
AGCCGATCCTGCTCGGCGGCGCGCCGAGGAGCATCGCCATCCTGAACGGCACGCTGGCCGGCGCGGTCGG
CCTCGGGTTGCAGCTTTGGCTGGCCGGTATCCTGATCTGGGCCGTTGGCCATCTCGCCACCGTCTGGGCT
GCGAAACGCGATCCGCTCTTCGTCGAGGTCGGGCGGCGGCATCTGCGTCTCCCCGGCCACCTCGCGGTCT
GA
 Primer design