SecReT4
Protein ID: 119385919
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3197
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]360637..363270 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA1B6Y4
KEGG IDpde:Pden_3197
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.4e-33, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 2.2e-12, Aligned region: 182..388
Protein Sequence: 877 a.a.     [Download]
>gi|119385919|ref|YP_916974.1| unnamed protein product [Paracoccus denitrificans PD1222]
MMNLAEYRGSASRLADFLPWAALVTPGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVAGRLNNAFRRLG
SGWAIFVEAQRSEAATYPDSTFPDAASALVDAERKADFEQAGSHFVSDYFLTLLWLPPAEEAARAESWLY
EGRETSGVNPWELLRGFTDRGDRVLALLDGFMPECAWLDDGETLTYLHSTISTNRQRVRVPEVPMHLDAL
LADQPLTGGLEPRLGDAHLRVLTITGFPTATTPGILDELNRIAFPYRWSTRAILIDKPDATRLLTRIRRQ
WFAKRKSIAAILKEVMTSEPSALVDTDAANKAADADLALQELGADVAGMAYVTATVTVWDADPRLADEKL
RLVEKIVQGRDFTAMIETVNAVDAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGEAKDAHFDAPP
LFYGKTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYSRAQVFAFDFGGSIRAAALAMG
GDWHDLGGGLSDGDEASVALQPLARIHETAERGWAADWIAAILRREGIAVTPEVKDHLWTALTSLASAPV
GERSVTGFAVLLQSNGLKQALRPYCIGGPSGRLLDAEAEHLGSAPVQAFEIEGLVGTGAAPAVLSYLFHR
IGDRLDGRPTLLIIDEGWLALDDEGFSGQLREWLKTLRKKNASVVFATQSLSDIDHSAIASAIIESCPTR
LLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEIGLALCAASAKSDQ
ARIAAIESEHGREGFLAAWLHDRGVDWAAGLIPDLADLAPEEDGMPASKQSNSEAALSDGEMNLADGGFP
DPEDGPAGDEIEPGDAEAASIPAEAGPEPNADKEIEP
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|119385557|ref|NC_008687.1|:360637-363270 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGATGAACCTCGCCGAATACCGCGGCAGCGCCTCCCGCCTCGCCGATTTCCTGCCCTGGGCGGCACTGG
TCACGCCGGGCGTGGTGCTGAACAAGGACGGTTCGTTCCAGCGCACCGCCCGGTTTCGCGGCCCCGATCT
TGACAGCGCCGTGGCTGCGGAACTGGTGGCGGTCGCCGGGCGGCTCAACAACGCCTTTCGCCGCCTCGGC
TCCGGCTGGGCCATCTTCGTCGAGGCGCAAAGATCCGAGGCCGCGACCTATCCGGACAGCACCTTCCCCG
ATGCCGCCTCGGCGCTGGTCGATGCCGAGCGCAAGGCCGATTTCGAGCAGGCGGGCAGCCATTTCGTCTC
CGACTATTTCCTCACCCTGCTCTGGCTGCCCCCTGCCGAGGAAGCCGCCCGCGCCGAAAGCTGGCTCTAC
GAGGGCCGCGAGACGTCCGGGGTAAACCCATGGGAGCTGCTGCGCGGCTTCACCGACCGCGGCGACCGGG
TGCTGGCGCTGCTCGACGGCTTCATGCCGGAATGTGCCTGGCTCGACGATGGCGAGACCCTGACCTACCT
GCATTCGACGATCTCCACCAACCGGCAGCGCGTGCGCGTGCCCGAGGTGCCGATGCATCTTGATGCCCTG
CTCGCCGATCAGCCGCTGACCGGCGGGCTGGAGCCGCGCCTCGGCGATGCGCATCTGCGGGTGCTGACCA
TCACCGGCTTTCCCACCGCAACCACGCCCGGCATTCTCGACGAGTTGAACCGCATCGCCTTTCCCTATCG
CTGGTCGACGCGCGCCATCCTGATCGACAAACCCGATGCGACCCGGCTGCTGACCCGGATCCGCCGGCAA
TGGTTCGCCAAGCGCAAGTCCATCGCCGCGATCCTCAAGGAGGTGATGACCAGCGAGCCCTCGGCGCTGG
TCGACACCGACGCCGCGAACAAGGCCGCCGACGCCGATCTGGCGCTGCAGGAACTCGGCGCCGATGTTGC
CGGGATGGCCTATGTCACCGCCACGGTCACCGTCTGGGATGCCGACCCGCGCCTTGCCGACGAGAAGCTG
CGGCTGGTGGAGAAGATCGTTCAGGGCCGCGACTTCACCGCGATGATCGAGACGGTCAATGCCGTCGATG
CCTGGCTCGGCAGCCTGCCCGGACACGCCTATGCCAATGTCCGCCAGCCGCCGGTTTCGACCTTGAATCT
TGCGCACATGATCCCGTTGTCCGCCGTCTGGGCGGGTGAGGCGAAGGACGCGCATTTCGATGCGCCGCCG
CTCTTCTATGGCAAGACCGAAGGCGCGACGCCGTTCCGCTTCTCGCTGCATGTCGGCGATGTCGGCCACA
CCCTCGTCGTCGGCCCCACAGGCGCGGGCAAATCGGTGCTGCTGGCGCTAATGGCGCTGCAATTCCGCCG
CTATTCGCGCGCGCAGGTCTTCGCCTTCGATTTCGGCGGCTCGATCCGCGCCGCAGCGCTGGCCATGGGC
GGCGACTGGCACGATCTCGGCGGCGGGCTGAGCGACGGCGATGAGGCGTCGGTTGCCTTGCAGCCTCTGG
CCCGTATCCACGAGACCGCCGAGCGTGGCTGGGCAGCGGACTGGATTGCGGCGATCCTGCGTCGGGAGGG
CATCGCCGTCACCCCCGAGGTCAAGGACCATCTCTGGACGGCACTGACCTCGCTGGCCTCGGCTCCGGTC
GGAGAGCGCTCCGTCACCGGCTTCGCGGTGCTGTTGCAGTCGAACGGGTTGAAGCAGGCGCTGCGGCCCT
ATTGCATCGGCGGCCCCTCAGGCCGGCTGCTCGACGCCGAGGCCGAACATCTCGGCTCGGCCCCGGTGCA
GGCCTTCGAGATCGAGGGGCTGGTCGGCACCGGCGCGGCGCCCGCCGTCCTCTCCTATCTGTTCCACCGC
ATCGGCGACCGGCTGGACGGCCGCCCGACGCTGCTGATCATCGACGAGGGCTGGCTGGCGCTCGACGACG
AGGGGTTTTCCGGCCAGCTGCGCGAATGGCTGAAGACGCTCCGGAAGAAGAACGCCTCGGTCGTCTTCGC
CACGCAGTCGCTGTCGGACATCGACCATTCCGCCATCGCGTCGGCGATCATCGAGTCCTGCCCGACGCGG
CTCTTGCTGCCGAACGAACGCGCCATCGAGCCGCAGATCACCGCCATCTATCGCCGTTTCGGGTTGAACG
ACCGCCAGATCGAGATCCTCGCCCGGGCCACCCCTAAGCGGGACTATTACTGCCAGTCCCGGCGCGGCAA
CCGGCTGTTCGAGTTGGGCCTGTCGGAAATCGGCCTCGCGCTCTGCGCCGCATCGGCCAAGTCCGATCAG
GCGCGCATCGCGGCGATCGAGTCTGAACATGGCCGCGAGGGTTTTCTGGCCGCCTGGCTGCACGACCGGG
GCGTCGACTGGGCCGCCGGGCTGATCCCGGACCTCGCCGATCTGGCGCCGGAGGAAGACGGCATGCCTGC
ATCCAAGCAATCCAACTCAGAAGCGGCACTCTCTGATGGCGAGATGAACCTCGCCGATGGCGGGTTCCCC
GACCCGGAGGACGGCCCTGCCGGTGACGAGATCGAGCCTGGCGACGCCGAGGCAGCATCCATCCCCGCAG
AAGCAGGACCAGAACCAAACGCAGACAAGGAGATCGAGCCATGA
 Primer design