SecReT4
Protein ID: 119385920
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3198
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]363267..364064 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1B6Y5
KEGG IDpde:Pden_3198
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 265 a.a.     [Download]
>gi|119385920|ref|YP_916975.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTRNTTAIPHPVRRIASTTALAVALAIPLALAPVLTTPAHAFFGGFGRIVYDPTNHAENLLTAARSLEQI
NNQIASLQNEAQMLINQARDLASLPHSSLQQLQQNVTRTQQLLDEAQNIAFEVQEVDQAFEREYGTPDLS
TSEQQLLADARTRWSNTMGGLQDAMRVQSGVTNNIEAQRAEMAALVEQSQNADGALQASQAGNQLLALQS
QQLSDLTALLAATGRAEALSEAERSAAAEQGRIQRERFLTPGAGYQPGNARMFND
 
Nucleotide Sequence: 798 bp     [Download]
>gi|119385557|ref|NC_008687.1|:363267-364064 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGACGCGCAATACGACCGCTATCCCGCACCCCGTTCGCCGCATCGCCAGCACCACGGCACTCGCCGTCG
CGCTCGCCATCCCGCTGGCGCTGGCCCCTGTCCTCACGACACCGGCCCATGCCTTCTTCGGTGGTTTTGG
GCGGATCGTCTACGACCCGACCAACCATGCCGAGAACCTGCTGACCGCCGCCAGGTCGCTGGAGCAGATC
AACAACCAGATCGCCTCGCTGCAGAACGAGGCGCAGATGCTGATCAACCAGGCCCGCGATCTCGCCAGCC
TGCCGCATAGCTCGCTGCAGCAATTGCAGCAGAACGTCACCCGCACCCAGCAGTTGCTCGACGAGGCCCA
GAACATCGCCTTCGAGGTGCAGGAGGTCGATCAGGCTTTCGAGCGGGAATACGGCACGCCGGATCTCTCG
ACATCCGAGCAGCAACTGCTGGCCGATGCCCGGACGCGCTGGAGCAACACCATGGGCGGGCTTCAGGACG
CCATGCGCGTCCAGTCCGGCGTCACCAACAACATCGAGGCGCAGCGGGCCGAGATGGCCGCGCTGGTCGA
GCAGAGCCAGAATGCTGACGGCGCCTTGCAGGCCAGCCAGGCCGGCAACCAGTTGCTGGCCCTGCAATCG
CAGCAACTGTCCGACCTCACCGCGCTCCTCGCCGCCACCGGCCGGGCCGAGGCACTGAGCGAGGCCGAGC
GCTCGGCGGCGGCCGAACAGGGCCGCATCCAGCGCGAACGGTTTCTGACACCCGGCGCCGGCTACCAGCC
CGGCAATGCCCGGATGTTCAACGACTGA
 Primer design