SecReT4
Protein ID: 119385922
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3200
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]364380..365702 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1B6Y7
KEGG IDpde:Pden_3200
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.9e-54, Aligned region: 37..262
Protein Sequence: 440 a.a.     [Download]
>gi|119385922|ref|YP_916977.1| unnamed protein product [Paracoccus denitrificans PD1222]
MGGSGVIDNFLAVFTSYIDSGFGLLGGEVAFIATTLIVIDVTLAALFWAWGAEDDILARLVKKTIFVGVF
AWLITNWNSLARIVFDSFAGLGLMASGTGFTAADLMRPGRVAQTGLDAGRPLLESISDLMGWVAVFENLI
QILCLFFAWALVILAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFMAERVLGNVVSSGIKVLVL
AVIIGIGSTLFSQFTTGFGGVAPTVDDAMAIVLAALSLLGLGIFGPGIATGLVSGGPQLGAGAVAGTGLA
VGGAALAAGGAAVLGAKGVAATARGGAATAGAASAAYTLNSAGQSGIGGAVSGAAGVGKGAGIAAMTPLR
RAAASLKASRDAGVKAAFTSTGGSTTQGTLGGPAAGVGGVAPTSGNAPAWAQRLRGQSLARGATVTAHAV
RASDSHGPGASVSLSESDKP
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|119385557|ref|NC_008687.1|:364380-365702 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGGGCGGATCCGGCGTCATCGACAATTTCCTGGCGGTCTTCACCAGCTATATCGACAGCGGCTTCGGTC
TTCTGGGCGGCGAGGTCGCCTTCATCGCCACCACGCTGATCGTCATCGACGTGACGCTGGCCGCCCTGTT
CTGGGCCTGGGGCGCCGAGGACGATATTCTGGCCCGGCTGGTGAAGAAGACCATCTTCGTCGGCGTCTTC
GCCTGGCTGATCACCAACTGGAACAGTCTCGCGCGCATCGTCTTCGACAGTTTCGCCGGTCTCGGGCTCA
TGGCCTCCGGCACCGGCTTCACCGCCGCCGATCTCATGCGCCCCGGCCGCGTCGCCCAGACCGGGCTCGA
TGCCGGACGGCCGCTCCTGGAATCCATCTCCGACCTGATGGGCTGGGTCGCGGTGTTCGAGAACCTGATC
CAGATCCTCTGCCTGTTCTTCGCCTGGGCGCTGGTGATCCTCGCCTTCTTCATCCTCGCCGTGCAGCTCT
TCGTCACCCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGATCCCCTTCGGGCTTTTCGG
CAAGACCGCCTTCATGGCCGAGCGCGTGCTGGGCAATGTCGTCTCCAGCGGTATCAAGGTTCTCGTGCTA
GCCGTCATCATCGGCATCGGCAGCACCTTGTTTTCGCAGTTCACCACCGGCTTCGGCGGTGTCGCGCCGA
CCGTGGACGACGCCATGGCCATCGTACTCGCGGCGCTGTCGCTCTTGGGCCTCGGTATCTTCGGGCCCGG
TATCGCCACCGGCTTGGTTTCCGGCGGTCCGCAGCTTGGCGCCGGGGCCGTTGCGGGGACAGGACTGGCC
GTGGGCGGCGCGGCACTGGCCGCCGGCGGCGCTGCGGTGCTCGGCGCCAAGGGCGTCGCTGCCACCGCGC
GGGGCGGGGCCGCGACGGCGGGGGCCGCCTCCGCCGCCTATACGCTGAACTCGGCCGGACAGTCCGGGAT
CGGCGGCGCCGTCTCCGGGGCCGCCGGTGTCGGCAAAGGCGCCGGCATCGCCGCCATGACCCCGCTGCGC
CGGGCGGCGGCCAGTCTCAAGGCCAGCCGCGACGCCGGCGTGAAAGCCGCCTTCACCAGCACCGGGGGAT
CGACCACGCAAGGAACGCTCGGCGGCCCGGCCGCTGGTGTCGGCGGTGTGGCGCCAACCAGCGGCAATGC
GCCCGCCTGGGCGCAGCGCCTGCGCGGCCAGTCCCTTGCCCGGGGCGCCACCGTCACCGCCCATGCGGTG
CGCGCCAGTGACAGCCACGGCCCCGGCGCCTCCGTCTCCCTTTCCGAAAGCGACAAGCCATGA
 Primer design