SecReT4
Protein ID: 119385923
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3201
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]365699..366388 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA1B6Y8
KEGG IDpde:Pden_3201
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.5e-62, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|119385923|ref|YP_916978.1| unnamed protein product [Paracoccus denitrificans PD1222]
MNPFRRSTTHYGETPEPETPYQKAAQVWDERIGSARVQARNWRLMAFACLFLAAGFAGALVWQSARGTVV
PWVVQVDDLGQAQTVAAATADYRPTDPQIAWHLGRFIEQVRSIPADPVILRQNWLQAYDWTTDRGAAALN
DHARGNDPFSKLGERQISVEVSSVIRASPDSFRVAWTEKRYENGQLSTTERWTAILTIGIQTPRTAEALR
ANPLGIYVNAISWSREMSQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|119385557|ref|NC_008687.1|:365699-366388 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGAACCCCTTCAGACGCTCGACCACCCATTACGGCGAGACACCCGAACCCGAGACGCCCTATCAGAAGG
CGGCGCAGGTCTGGGACGAGCGCATCGGCTCGGCCCGGGTGCAGGCCAGGAACTGGCGGCTGATGGCCTT
CGCCTGCCTGTTCCTGGCCGCCGGCTTTGCCGGGGCGCTGGTCTGGCAATCGGCGCGTGGCACTGTCGTA
CCTTGGGTGGTGCAGGTCGACGATCTGGGGCAGGCGCAGACCGTGGCCGCCGCCACGGCGGATTACCGCC
CGACCGATCCGCAGATCGCCTGGCATCTCGGCCGTTTCATCGAGCAGGTCCGGTCTATCCCGGCCGATCC
GGTCATCCTGCGCCAGAACTGGCTCCAGGCCTATGACTGGACCACCGATCGCGGCGCCGCGGCGCTGAAC
GACCATGCCCGCGGCAACGATCCCTTCTCGAAGCTGGGCGAGCGGCAGATCTCGGTCGAGGTCTCCTCGG
TCATCCGCGCCTCGCCGGACAGCTTCCGGGTCGCCTGGACGGAAAAGCGCTACGAGAACGGCCAGTTGTC
TACGACCGAACGCTGGACCGCGATCCTGACTATCGGCATCCAGACACCCCGCACCGCCGAGGCCCTGCGC
GCCAATCCGCTCGGCATCTACGTCAATGCGATCTCATGGTCGCGGGAGATGAGCCAATGA
 Primer design