SecReT4
Protein ID: 119385924
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3202
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]366385..367428 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1B6Y9
KEGG IDpde:Pden_3202
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.7e-63, Aligned region: 108..328
Protein Sequence: 347 a.a.     [Download]
>gi|119385924|ref|YP_916979.1| unnamed protein product [Paracoccus denitrificans PD1222]
MTAIRFERLVGDRTGSLSKSAILPVVVLAMTTLAGCATTKTPQFSYDDHVPPLPSPPAAVADPAPEPLHV
PPDWTPAKGGNAAESPAGQVTNANLAARVEPRREGYYNAIQVYPWSEGALYQIYAAPGQITDIALEPGER
LTSTGPIAAGDTARWIIGDTESGSGASRRVHVLVKPTRPEISTNLVIATDRRRYMLELRADEETWMPAVS
WHYPESASAAAQRRAAPAAPVIPGKAARNHRYGLQVLGASPPWRPVSVFDDGRRVHVVFPPGIAQGEMPP
LFVIGPDGAPEIVNSRVHGNVLIVDRLFGVAELRLGSGKRQQVVRIIRMEQTRAAIQPTRAPTKGSS
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|119385557|ref|NC_008687.1|:366385-367428 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGACCGCAATTCGCTTCGAACGATTGGTTGGCGACAGGACGGGATCGCTGAGCAAATCCGCAATCCTTC
CTGTCGTGGTACTCGCGATGACCACACTCGCCGGCTGCGCCACGACCAAAACGCCACAGTTCAGCTATGA
CGACCACGTGCCGCCATTGCCATCGCCGCCCGCCGCCGTTGCCGATCCGGCTCCGGAACCGCTGCATGTG
CCGCCGGACTGGACCCCGGCGAAGGGTGGGAATGCAGCGGAAAGCCCGGCAGGCCAGGTTACGAACGCCA
ACCTCGCCGCCCGGGTGGAGCCGCGCCGGGAGGGCTATTACAACGCCATCCAGGTCTATCCGTGGAGCGA
AGGCGCGCTCTATCAGATCTATGCGGCGCCGGGGCAGATCACCGATATCGCGCTGGAGCCGGGCGAGCGC
CTGACCAGCACCGGTCCCATCGCCGCAGGCGACACCGCCCGCTGGATCATCGGCGATACGGAGAGCGGCA
GCGGCGCGTCCCGCCGCGTGCATGTGCTGGTCAAGCCGACCCGGCCCGAGATCAGCACCAATCTGGTCAT
CGCCACCGACCGGCGCCGCTACATGCTGGAATTGCGCGCCGACGAAGAAACCTGGATGCCGGCGGTGTCG
TGGCATTATCCGGAAAGCGCGTCTGCGGCCGCACAGCGTCGCGCGGCTCCTGCCGCGCCGGTGATTCCGG
GGAAGGCTGCGCGCAACCATCGCTACGGCTTGCAGGTCCTAGGCGCGAGCCCGCCCTGGCGCCCGGTCTC
GGTCTTCGACGACGGCCGCCGGGTCCATGTGGTCTTCCCGCCCGGCATCGCCCAGGGCGAGATGCCGCCC
CTCTTTGTCATCGGCCCGGACGGCGCCCCCGAGATCGTCAACAGCCGTGTCCACGGCAATGTGCTGATCG
TGGACCGGCTCTTCGGCGTGGCCGAACTGCGCCTCGGCTCGGGAAAACGCCAGCAGGTGGTCAGGATTAT
CCGTATGGAACAGACACGGGCGGCCATCCAGCCGACCCGTGCGCCGACGAAAGGATCGTCCTGA
 Primer design