SecReT4
Protein ID: 119385925
T4SS name [ID]Trb [305]
Gene symbol-
Locus tagPden_3203
StrainParacoccus denitrificans PD1222
Repliconchromosome 2 [GenBank: NC_008687] [Browse all T4SS(s) in this replicon]
Location [Strand]367428..368594 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA1B6Z0
KEGG IDpde:Pden_3203
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.8e-60, Aligned region: 203..382
Protein Sequence: 388 a.a.     [Download]
>gi|119385925|ref|YP_916980.1| unnamed protein product [Paracoccus denitrificans PD1222]
MSDRDTAAAPLRLRAEPPRVTRLSRKVLAGLGGIAALGIGAALIFALQTRDVERGGEELFSTENRATADG
LAELPRDYAGPVLGPALPGDLGKPILNARNRGEPVPAPGTPTVTAPAMDAAEQQRLAEEEAARLSGVFFQ
GGPRSAGGSDMGAGPAGQTPGALGTMGQPGAAATQDRHAAFLGGAADRITVAPDRVEAPASPYLLQAGSV
IPAALITGIRSDLPGQIIAQVTQPVYDSPTGSILLIPQGTRVIGEYDASVTFGQRRVLLVWNRLIFPDGR
SLVLERLPGADASGYAGLEDGVDYHWGELIKAAGLSTLLAVGTELTAGDDDDRLVRAIRDGAQDTVDQAG
QQIVQRQLLVAPTLTIRPGFPVRILVGRDLVFENAGER
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|119385557|ref|NC_008687.1|:367428-368594 Paracoccus denitrificans PD1222 chromosome 2, complete sequence
ATGAGCGACAGGGACACCGCCGCCGCGCCGCTGCGCCTGCGGGCAGAGCCGCCCCGTGTCACCCGGTTGT
CGCGCAAGGTGCTGGCGGGCCTCGGTGGGATCGCCGCACTCGGCATCGGGGCGGCGCTGATCTTTGCCCT
GCAAACCCGCGACGTCGAGCGCGGCGGCGAGGAACTGTTCTCCACCGAAAACCGCGCCACCGCCGACGGG
CTGGCGGAACTGCCGCGCGACTATGCCGGTCCCGTCCTCGGCCCGGCGCTGCCCGGGGATCTCGGCAAGC
CGATCCTCAATGCGCGCAATCGTGGTGAGCCGGTGCCCGCGCCCGGCACGCCCACCGTCACCGCACCCGC
CATGGATGCGGCGGAGCAGCAGCGGCTGGCGGAAGAAGAGGCGGCAAGGCTCAGCGGCGTGTTCTTTCAG
GGTGGGCCACGGTCTGCGGGCGGGTCGGACATGGGCGCAGGGCCAGCCGGTCAGACCCCAGGCGCGCTTG
GCACCATGGGACAGCCCGGCGCCGCAGCCACGCAGGACCGGCATGCGGCGTTCCTGGGCGGCGCCGCAGA
TCGCATCACCGTTGCCCCGGATCGTGTCGAAGCTCCTGCCTCACCCTATCTGCTGCAGGCCGGATCGGTG
ATCCCGGCGGCGCTGATCACCGGCATCCGCTCCGATCTGCCCGGCCAGATCATCGCCCAGGTGACGCAGC
CGGTCTACGACAGCCCTACCGGCTCGATCCTGCTGATCCCGCAGGGCACCCGCGTCATCGGCGAATACGA
TGCCAGTGTCACATTCGGCCAGCGCCGGGTGCTGCTCGTCTGGAACAGGCTGATCTTTCCCGATGGCCGC
TCGCTGGTGCTGGAGCGCCTGCCGGGCGCCGATGCCAGCGGCTATGCCGGGCTCGAGGACGGGGTCGATT
ACCATTGGGGAGAGCTGATAAAGGCGGCCGGGCTGTCGACGCTGCTGGCGGTCGGCACCGAACTCACCGC
CGGTGACGACGACGACCGGCTGGTCCGCGCCATCCGCGACGGCGCCCAGGATACCGTCGACCAGGCCGGC
CAGCAGATCGTCCAGCGCCAGCTGCTGGTCGCCCCCACGCTGACCATCCGGCCCGGATTCCCGGTCAGGA
TTCTTGTCGGCAGAGACTTGGTCTTCGAGAACGCAGGAGAAAGATGA
 Primer design