SecReT4
Protein ID: 120537061
T4SS name [ID]Tfc [725]
Gene symbol-
Locus tagMaqu_3923
StrainMarinobacter aquaeolei VT8
Repliconplasmid pMAQU02 [GenBank: NC_008739] [Browse all T4SS(s) in this replicon]
Location [Strand]24280..25509 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1U884
KEGG IDmaq:Maqu_3923
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 409 a.a.     [Download]
>gi|120537061|ref|YP_957118.1| hypothetical protein Maqu_3923 [Marinobacter aquaeolei VT8]
MLSGPPTAVHTVPVLSFGSGWDLGMECGKFDPKITVSNQLNGITDGFKNMMNNIIQSATGAVASLPALAI
QRADPALYDLLQQGILQGKMDFEWAETSCQEMASVMMGDQGFPFEKFKVNAQVSEWAYQIGAKGGDAKAT
KDEVDRLEAGNEGAEWICGVKKGGVAMPPINALRDVVIVGYNVLFDQSNPCTTASIPPAAGQGTPLWEYW
SGPVAAATWAMEVVGDTEIRTCETCKKLETTPGKGLTYKHRDMSDSIYNDLEDLVNGVTPMTWQNLNRVS
APPGVLVDDTVIAAIRKRPLDSQPTMIRKLAGEIAYTRLVEQGRLLTQMLRSGVKEPNVSNLQSAKAVVN
DAIDHLQVELDQLDNEIKTRQAIAKLTIQRIVGAEEREVQNTRAPSRAKPTGLNSLGQP
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|120537037|ref|NC_008739.1|:c25509-24280 Marinobacter aquaeolei VT8 plasmid pMAQU02, complete sequence
ATGCTGTCAGGGCCTCCAACGGCCGTTCATACCGTTCCGGTGCTCAGTTTCGGTTCAGGCTGGGATCTCG
GTATGGAGTGCGGGAAGTTTGATCCGAAGATTACGGTGTCAAATCAGTTAAACGGTATCACCGATGGCTT
CAAGAACATGATGAACAACATCATCCAGTCGGCCACCGGAGCGGTAGCATCCTTGCCCGCGCTGGCAATC
CAGCGAGCGGACCCGGCACTGTATGACCTTCTTCAGCAGGGCATTTTGCAGGGAAAAATGGACTTTGAGT
GGGCCGAGACATCCTGTCAGGAAATGGCGTCGGTCATGATGGGCGATCAGGGCTTTCCGTTTGAGAAATT
CAAAGTGAATGCCCAGGTTTCCGAGTGGGCTTACCAAATTGGGGCTAAAGGTGGTGATGCTAAAGCCACC
AAGGATGAAGTTGATAGGCTGGAAGCGGGTAACGAAGGGGCGGAGTGGATCTGCGGCGTCAAGAAAGGGG
GCGTAGCAATGCCGCCCATCAATGCGCTGCGAGATGTCGTGATTGTCGGGTACAACGTGCTGTTCGATCA
GAGTAACCCCTGCACCACGGCCAGTATTCCTCCGGCTGCCGGTCAGGGGACACCGCTCTGGGAGTACTGG
AGTGGTCCGGTCGCCGCCGCCACATGGGCCATGGAAGTGGTGGGTGATACTGAAATCCGAACGTGTGAGA
CCTGTAAGAAACTGGAAACCACGCCGGGTAAAGGTCTGACCTACAAGCACCGGGATATGTCGGACAGTAT
CTACAACGATCTGGAAGACCTCGTGAACGGTGTGACGCCAATGACCTGGCAGAATCTGAACAGAGTGTCT
GCACCACCGGGGGTGTTGGTTGACGACACGGTGATTGCGGCGATCCGAAAGCGACCGCTGGATAGCCAGC
CAACCATGATTCGGAAGTTAGCCGGTGAAATTGCTTACACCCGCCTGGTCGAGCAGGGCAGGTTACTGAC
ACAAATGCTTCGTTCGGGTGTTAAAGAGCCTAATGTGTCCAATCTGCAGTCGGCCAAAGCTGTGGTCAAT
GATGCAATTGATCACCTGCAGGTTGAACTCGACCAACTCGATAATGAAATCAAAACCCGTCAGGCCATTG
CGAAGCTGACCATTCAACGCATCGTTGGTGCTGAAGAGCGTGAAGTCCAGAATACTCGGGCACCTTCGAG
GGCAAAACCAACCGGCCTGAATTCGCTGGGGCAGCCTTGA
 Primer design