SecReT4
Protein ID: 120537069
T4SS name [ID]Tfc [725]
Gene symbol-
Locus tagMaqu_3931
StrainMarinobacter aquaeolei VT8
Repliconplasmid pMAQU02 [GenBank: NC_008739] [Browse all T4SS(s) in this replicon]
Location [Strand]33810..34217 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA1U892
KEGG IDmaq:Maqu_3931
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1e-36, Aligned region: 9..125
Protein Sequence: 135 a.a.     [Download]
>gi|120537069|ref|YP_957126.1| hypothetical protein Maqu_3931 [Marinobacter aquaeolei VT8]
MNQPGMKGREIDFIPDRLIEEPVVFRGLTDTEVVVLISVGLVFWIPVSVLVLLPFGWGLFGVGIGVGMAI
ASLLVIGKYLQELKRRRPDGLHIVYLKKLAQKKFSFINFNYIETSQGWDIRREKPVVRIHMETEE
 
Nucleotide Sequence: 408 bp     [Download]
>gi|120537037|ref|NC_008739.1|:c34217-33810 Marinobacter aquaeolei VT8 plasmid pMAQU02, complete sequence
ATGAATCAACCAGGAATGAAGGGTCGAGAAATCGACTTCATCCCCGACCGGCTCATTGAAGAGCCGGTTG
TTTTCCGGGGGCTAACGGATACGGAAGTCGTTGTTCTCATCAGCGTTGGCCTAGTTTTTTGGATTCCTGT
CTCAGTTCTGGTGCTACTGCCGTTCGGGTGGGGGTTGTTTGGCGTTGGGATCGGAGTGGGTATGGCCATC
GCCAGTTTGCTGGTCATAGGGAAATACCTTCAGGAGCTGAAGCGCCGCAGACCTGACGGTTTGCATATTG
TCTATCTGAAGAAACTTGCCCAGAAAAAATTCAGTTTTATCAATTTCAACTACATCGAGACGTCCCAAGG
CTGGGATATACGGCGCGAGAAGCCCGTTGTTCGAATTCACATGGAGACGGAGGAGTGA
 Primer design