SecReT4
Protein ID: 120537073
T4SS name [ID]Tfc [725]
Gene symbol-
Locus tagMaqu_3936
StrainMarinobacter aquaeolei VT8
Repliconplasmid pMAQU02 [GenBank: NC_008739] [Browse all T4SS(s) in this replicon]
Location [Strand]37921..38649 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1U896
KEGG IDmaq:Maqu_3936
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2e-60, Aligned region: 43..239
Protein Sequence: 242 a.a.     [Download]
>gi|120537073|ref|YP_957130.1| hypothetical protein Maqu_3936 [Marinobacter aquaeolei VT8]
MAEASTEHPARRRGPIGKTIELVLKIIGLLLFSAFMSVVIEWVGMAFFYDEPGYAHAESMMQTEIGYLSE
SLTGGDGMNEGAISSASETVSTVANFLFIDSGIVDNLQAVKTVSPDDGEIKAAVKRLVAGYYDYLMAAVY
VLIMFLVRMAILFLSMPAFILFGIVGISDGLMQRDLRRWCGGNESGYVYHWAKRFSLPVLALAWILYLSI
PNSIHPNFIITPFAVLFGLCLMVMTSKFKKYL
 
Nucleotide Sequence: 729 bp     [Download]
>gi|120537037|ref|NC_008739.1|:c38649-37921 Marinobacter aquaeolei VT8 plasmid pMAQU02, complete sequence
ATGGCTGAGGCGAGCACTGAACACCCGGCCCGGCGGCGAGGGCCCATAGGCAAGACGATTGAGCTGGTTC
TCAAAATAATCGGATTGCTCCTTTTTTCTGCCTTTATGTCCGTAGTAATCGAGTGGGTCGGTATGGCGTT
TTTCTACGACGAGCCAGGATACGCCCACGCCGAGTCCATGATGCAAACGGAGATTGGGTATTTGAGCGAG
TCCCTGACAGGCGGGGACGGCATGAATGAAGGTGCGATTTCATCGGCCAGTGAAACCGTAAGTACCGTAG
CGAATTTTCTTTTTATCGATTCAGGTATTGTCGACAATCTTCAAGCGGTAAAAACGGTGTCTCCGGATGA
CGGTGAGATCAAGGCTGCAGTAAAGAGGCTAGTAGCAGGATATTACGACTACCTCATGGCGGCAGTTTAC
GTTCTGATCATGTTCCTGGTTCGAATGGCCATTCTCTTTCTGTCGATGCCGGCTTTCATACTGTTCGGCA
TTGTAGGGATCAGCGATGGACTGATGCAGCGGGATCTTCGGCGCTGGTGTGGCGGGAATGAATCCGGGTA
TGTCTATCACTGGGCAAAACGATTCTCCCTACCGGTATTGGCCCTCGCCTGGATTCTCTACCTGTCGATT
CCAAATTCGATCCATCCGAACTTTATTATCACGCCGTTTGCGGTTCTTTTTGGGCTTTGTCTGATGGTCA
TGACCTCGAAGTTCAAAAAGTATCTTTGA
 Primer design