SecReT4
Protein ID: 120537076
T4SS name [ID]Tfc [725]
Gene symbol-
Locus tagMaqu_3939
StrainMarinobacter aquaeolei VT8
Repliconplasmid pMAQU02 [GenBank: NC_008739] [Browse all T4SS(s) in this replicon]
Location [Strand]41246..41782 [-]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDA1U899
KEGG IDmaq:Maqu_3939
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 178 a.a.     [Download]
>gi|120537076|ref|YP_957133.1| lytic transglycosylase, catalytic [Marinobacter aquaeolei VT8]
MSLVRMLTLMLLFISGPSAASDIPEMYLQVAEEQDVPAKLFYAIILNESRSTNKHINRVLPWPWTINHRG
TPHFFHNRAAAYRFARQLVESGDYQFDVGLGQMNWRWHRHRFSDLWDALDPYMNLTASAAHLREQYERPE
CNSWDLAIGCYHRPAQKPLDKRIAANYRERVMKLWSNI
 
Nucleotide Sequence: 537 bp     [Download]
>gi|120537037|ref|NC_008739.1|:c41782-41246 Marinobacter aquaeolei VT8 plasmid pMAQU02, complete sequence
ATGAGCCTCGTTCGTATGCTAACCCTAATGCTTCTATTCATTAGTGGCCCGAGCGCCGCTTCAGACATAC
CTGAAATGTATCTACAGGTCGCAGAAGAACAAGATGTTCCTGCAAAGCTTTTTTACGCGATCATTTTGAA
TGAAAGCCGCAGCACCAATAAGCATATCAACAGAGTATTGCCCTGGCCCTGGACGATTAACCACCGGGGC
ACTCCACATTTTTTCCATAACAGAGCCGCTGCTTATCGGTTTGCACGACAGTTGGTGGAATCCGGTGATT
ACCAGTTCGATGTCGGTCTTGGACAGATGAACTGGCGCTGGCATCGCCATCGTTTTAGTGACCTGTGGGA
TGCGTTGGATCCTTACATGAACCTGACAGCGTCAGCCGCACACCTGAGGGAGCAATACGAACGCCCCGAG
TGTAATTCCTGGGATCTTGCCATTGGTTGTTATCACAGACCCGCACAGAAGCCATTGGATAAAAGAATTG
CTGCCAACTACCGAGAGAGAGTTATGAAACTATGGTCAAACATCTGA
 Primer design