SecReT4
Protein ID: 120597928
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1098
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1248113..1250263 [+]
Productmetal dependent phosphohydrolase
Component typeTraI_F
UniProt IDA1RH03
KEGG IDshw:Sputw3181_1098
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 4.9e-119, Aligned region: 32..353
Protein Sequence: 716 a.a.     [Download]
>gi|120597928|ref|YP_962502.1| metal dependent phosphohydrolase [Shewanella sp. W3-18-1]
MFKKLFFQAKAIPELSSQLDADIPRYPPFLKGLPAASPEELQSTQDELIAKLRQVLGFNQRDFQKLIQPC
IDHLAAYVHLLPASEHHHHSGAGGLLRHSLEVAFWAAQAAEGIIFVASGTPVEKKELEPRWRVAAALGGL
FHDIGKPVSDLSITDEDGRYQWNPFLETLSQWTTNNSIERYFIRWRDGRCKRHEQFSILVLNRVMTPELL
AWLTQPGPEILQAMLEAIGNTDPEHVLSKLVIEADQTSVQRDLKAQRISVDDNALGVPVERYLLDAMRRL
LASSQWLVNQRDARVWVQKSNQSTHLYLVWKSAAKDIIELLAKDKIPGIPRDPDTLADILIERGLATKSA
SNERYESLAPEVLIKDDKPIWLPMLHISEADLLFSSNVPSSVTLFSKSEWEATQQTQAEPQSRSSEHPDL
PEASSSIEHSNSAQSPSTKPSDQDDELRLASDVNNHQATENVPGDGCEKPNNSYDGAISNNVNQYDADSL
NLPESLAWLPEASSALIMVGEQALIRYPDAVRPWCAPRKLLAELSRLDWLELDPANPTRKARTVTTKDGV
QEQGLLLKVSISKGLTALIDISKQDEESVAAIQNKEASQRPSRTETTSAQAKELATRAERKQTPIAPNAN
SSTDPKHAQRQQMVNFVKDLPILLTDGDYPDVDHSADGIRVTIQTLRQVAKEHGIPAGQLLRGISASDQC
QFDEGETVLFTAHAKR
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1248113-1250263 Shewanella sp. W3-18-1 chromosome, complete genome
ATGTTCAAAAAACTATTTTTTCAAGCCAAAGCAATACCAGAGCTGTCATCTCAACTGGATGCAGACATTC
CACGCTATCCGCCATTTCTGAAGGGGTTGCCTGCTGCGTCACCCGAGGAATTGCAGTCCACACAAGACGA
GCTAATTGCCAAACTGCGCCAGGTACTTGGCTTCAACCAGCGTGATTTTCAAAAGCTGATTCAGCCCTGC
ATTGATCATCTGGCTGCTTATGTTCATTTGTTGCCAGCTTCTGAGCATCATCATCACAGTGGCGCTGGTG
GTTTATTACGTCATTCTTTGGAAGTTGCTTTCTGGGCGGCACAAGCAGCTGAAGGGATCATCTTTGTTGC
CAGTGGCACACCGGTTGAGAAAAAAGAGCTAGAGCCAAGGTGGCGTGTTGCGGCGGCATTAGGCGGTTTG
TTCCATGATATTGGTAAGCCCGTTTCAGACTTGTCTATCACTGACGAAGATGGACGCTATCAGTGGAACC
CTTTTTTAGAAACCTTATCTCAATGGACCACAAATAACAGCATTGAACGCTATTTTATTCGCTGGCGCGA
CGGACGGTGCAAGCGGCACGAGCAATTTTCAATTCTGGTGTTAAACCGGGTGATGACACCTGAGTTGCTC
GCCTGGTTAACCCAGCCGGGCCCAGAGATTTTGCAAGCCATGCTAGAAGCAATTGGCAATACCGATCCCG
AGCATGTCCTGTCTAAACTGGTCATTGAAGCTGACCAAACCAGTGTCCAGCGAGACCTGAAAGCTCAACG
AATTTCCGTTGACGACAACGCCCTTGGTGTCCCAGTCGAACGCTATCTACTTGATGCCATGAGGCGATTG
CTTGCCAGTTCTCAGTGGTTAGTTAATCAGCGAGACGCCAGAGTCTGGGTACAAAAATCCAATCAATCAA
CCCATCTTTACCTGGTTTGGAAAAGCGCGGCTAAGGACATCATTGAGCTATTGGCCAAAGACAAGATACC
TGGCATTCCAAGAGATCCCGATACCCTTGCGGACATCCTCATTGAGCGGGGATTGGCCACAAAATCAGCC
TCAAATGAGCGATATGAAAGCCTTGCCCCTGAAGTGCTGATCAAAGACGACAAGCCAATCTGGTTACCCA
TGCTGCATATATCTGAGGCCGATTTATTGTTCAGCTCGAATGTACCAAGTAGCGTGACACTGTTTAGCAA
ATCTGAGTGGGAAGCAACACAGCAAACACAAGCAGAACCTCAGAGTCGTTCCAGTGAGCATCCAGACTTG
CCTGAAGCGTCATCATCAATCGAACATAGCAATTCGGCACAGTCGCCATCAACAAAACCGTCCGACCAAG
ATGATGAACTTCGTCTTGCTAGTGATGTTAATAACCACCAGGCAACTGAAAACGTTCCGGGTGATGGATG
TGAAAAGCCTAACAATTCATATGATGGCGCTATCTCAAATAACGTAAACCAGTACGATGCAGATTCATTG
AATCTCCCTGAATCTTTGGCGTGGCTCCCAGAGGCCAGCAGTGCGTTGATTATGGTTGGTGAGCAAGCCC
TGATCCGCTATCCCGATGCCGTAAGACCTTGGTGTGCCCCCCGAAAACTACTTGCTGAACTCAGTCGATT
AGATTGGCTTGAACTAGATCCCGCAAACCCGACACGTAAGGCCAGAACTGTGACTACGAAGGATGGCGTT
CAGGAGCAAGGGTTACTACTGAAAGTATCGATTTCTAAGGGGCTTACTGCACTGATAGACATCTCCAAAC
AAGACGAAGAATCAGTGGCAGCAATTCAGAACAAAGAGGCTTCACAGCGTCCGAGTCGAACTGAGACAAC
CAGTGCCCAAGCAAAAGAGCTCGCCACAAGAGCTGAGCGCAAGCAAACGCCGATTGCGCCCAATGCGAAC
TCAAGTACAGACCCCAAACACGCACAGCGGCAACAGATGGTTAATTTTGTGAAAGATTTGCCCATCTTAC
TGACCGATGGCGATTACCCAGACGTGGATCATAGTGCCGATGGTATTCGCGTCACGATTCAAACCTTACG
TCAAGTCGCCAAGGAGCATGGCATTCCAGCCGGACAGCTGCTTCGGGGGATCTCGGCCAGTGACCAATGC
CAGTTTGATGAGGGGGAAACGGTTCTGTTTACCGCTCACGCTAAACGTTAA
 Primer design