SecReT4
Protein ID: 120597929
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1099
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1250312..1252135 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDA1RH04
KEGG IDshw:Sputw3181_1099
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2e-19, Aligned region: 156..528
TrwB_AAD_bind [PF10412], Evalue: 2.2e-19, Aligned region: 152..291
TrwB_AAD_bind [PF10412], Evalue: 2.2e-19, Aligned region: 449..587
TraG-D_C [PF12696], Evalue: 5.8e-14, Aligned region: 452..579
FtsK_SpoIIIE [PF01580], Evalue: 3.6e-08, Aligned region: 148..198
T4SS-DNA_transf [PF02534], Evalue: 1.9e-05, Aligned region: 154..247
DUF87 [PF01935], Evalue: 2.5e-05, Aligned region: 157..194
Protein Sequence: 607 a.a.     [Download]
>gi|120597929|ref|YP_962503.1| hypothetical protein Sputw3181_1099 [Shewanella sp. W3-18-1]
MKENAYEMPWRTNYEAMAAAGWLVVGATGAIAAEMLTELPPEPFWWMTGISSGMALYRLPEAYRLYKLQK
GLKGKPLAFMALSHLQKVMAKHPDELWLGYGFEWDQRHAQRAYEILKRDKQTLLNQGHGKQMGSTWIHGV
EPKEEDVYQPVGHTEGHTLIVGTTGAGKTRCFDAMITQAILRNEAVIIIDPKGDKELKDNAQRACIAAGS
PERFVYFHPGFPEHSVRLNPLRNFNRGTEIASRIAALIPSETGADPFKAFGQMALNNIVQGLLLTSQRPD
LKTLRRFLEGGPEGLVVKAVTAWGEQVYPNFSVEIKRFTEKANTLAKQAMAMLLFYYERIQPVAANTDLE
GLLSMFEHDRTHYSKMVASLMPVLNMLTSSELGPLLSPIANDVDDSRLITDSGRIINNAQVAYIGLDSLT
DAMVGSAIGSLLLSDLTAVAGDRYNYGVENRPVNIFIDEAAEVVNDPFIQLLNKGRGAKMRCVIATQTFA
DFAARTGSEAKARQVLGNINNLIALRVMDAETQQYITDNLPKTRLQYIMQTQGMSSNSDSPALFTGNHGE
RLMEEEGDMFPPQLLGQLPNLEYIAKLSGGRVIKGRIPILTSSTQAA
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1250312-1252135 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAGAAAACGCATACGAAATGCCCTGGCGCACGAACTATGAGGCCATGGCAGCAGCAGGTTGGCTGG
TGGTTGGGGCCACTGGGGCGATTGCCGCAGAAATGCTGACTGAGCTACCACCTGAGCCATTTTGGTGGAT
GACAGGGATTTCCTCGGGCATGGCGTTGTATCGCCTGCCTGAGGCTTACCGTCTTTATAAGTTGCAGAAG
GGGCTAAAAGGCAAACCATTGGCATTTATGGCGCTGTCGCATTTGCAAAAGGTAATGGCAAAACATCCTG
ATGAATTGTGGTTAGGTTATGGCTTTGAGTGGGACCAACGCCATGCCCAACGCGCTTATGAAATCCTAAA
GCGGGATAAGCAAACCTTGCTTAACCAAGGTCACGGCAAACAAATGGGTTCGACCTGGATTCATGGTGTC
GAGCCCAAAGAAGAAGATGTGTACCAGCCAGTTGGTCACACCGAGGGGCATACCTTAATTGTCGGTACGA
CCGGTGCCGGAAAAACCCGATGCTTTGATGCGATGATCACTCAGGCCATTTTGCGTAATGAAGCCGTGAT
TATTATTGACCCTAAGGGAGACAAGGAACTTAAGGATAATGCGCAGCGAGCCTGTATTGCCGCCGGTAGT
CCTGAGCGCTTTGTGTATTTTCATCCGGGTTTTCCTGAGCATTCGGTACGGCTTAATCCCCTTAGAAACT
TTAACCGGGGCACTGAAATTGCCAGCCGAATTGCGGCACTAATCCCATCTGAAACCGGTGCTGATCCATT
TAAAGCCTTTGGCCAAATGGCATTGAACAACATAGTGCAAGGTCTGTTGCTTACGTCACAACGTCCTGAT
CTGAAAACACTGAGGCGATTCTTGGAAGGTGGCCCAGAAGGCTTGGTAGTAAAAGCCGTCACAGCCTGGG
GTGAGCAGGTGTATCCGAACTTTAGTGTGGAGATCAAGCGCTTTACCGAAAAGGCCAATACCTTGGCTAA
ACAAGCCATGGCGATGCTGCTTTTCTACTACGAACGCATTCAGCCCGTTGCCGCCAATACCGATTTGGAA
GGACTTTTGAGTATGTTTGAGCATGACAGAACCCACTATTCCAAGATGGTGGCCTCACTGATGCCGGTGC
TCAATATGCTCACATCAAGTGAATTAGGGCCACTGTTATCACCGATTGCAAACGATGTGGATGACAGCCG
GTTAATTACGGATTCTGGCCGTATTATCAACAATGCCCAAGTGGCGTATATCGGCTTGGATTCATTAACT
GACGCCATGGTTGGCAGCGCCATTGGTTCGTTGCTTTTGTCCGATCTCACTGCTGTGGCCGGTGATCGCT
ATAACTATGGTGTTGAAAATCGTCCCGTAAATATCTTCATCGATGAGGCGGCTGAAGTCGTCAACGATCC
CTTCATTCAACTGCTCAACAAAGGCCGTGGCGCAAAAATGCGTTGTGTAATTGCTACTCAGACCTTTGCT
GACTTTGCAGCTCGTACAGGCAGTGAAGCTAAGGCTCGCCAGGTGTTAGGTAACATCAACAACTTGATAG
CCCTTCGGGTGATGGATGCCGAAACGCAGCAGTACATTACCGACAATCTGCCTAAGACTCGGTTGCAGTA
CATCATGCAAACTCAAGGTATGTCGTCCAACTCGGACAGCCCCGCGTTGTTTACCGGCAATCATGGCGAA
CGCTTGATGGAGGAAGAAGGCGATATGTTTCCACCGCAGTTATTAGGCCAGCTTCCCAACCTGGAGTACA
TCGCCAAGCTTTCAGGTGGCCGCGTGATCAAAGGCCGCATTCCTATTTTAACCAGCTCTACACAGGCAGC
ATAA
 Primer design