SecReT4
Protein ID: 120597934
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1104
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1254230..1254511 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDA1RH09
KEGG IDshw:Sputw3181_1104
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.8e-16, Aligned region: 4..92
Protein Sequence: 93 a.a.     [Download]
>gi|120597934|ref|YP_962508.1| hypothetical protein Sputw3181_1104 [Shewanella sp. W3-18-1]
MEPVNIPSYIDDPPHFLLWSADEMAPILLGLVIGIFTGNALVLCLLGLVTTKLYRRFRDGRPDGFILHAI
YWGGLLPTKAKTIPNPFIRSYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1254230-1254511 Shewanella sp. W3-18-1 chromosome, complete genome
ATGGAACCTGTAAATATTCCATCCTATATCGATGACCCGCCGCACTTCCTGCTTTGGAGTGCCGATGAGA
TGGCTCCCATTCTGTTGGGGCTAGTGATCGGCATTTTTACCGGTAATGCCTTGGTTTTATGCCTGTTGGG
GTTGGTAACAACCAAGCTCTATCGGCGTTTTCGTGATGGCCGCCCAGATGGTTTTATTCTTCACGCCATC
TACTGGGGCGGACTGTTGCCAACCAAAGCCAAGACGATCCCTAACCCATTTATCAGGAGCTATCTGCCGT
GA
 Primer design