SecReT4
Protein ID: 120597935
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1105
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1254508..1255134 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDA1RH10
KEGG IDshw:Sputw3181_1105
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 8.4e-16, Aligned region: 22..175
Protein Sequence: 208 a.a.     [Download]
>gi|120597935|ref|YP_962509.1| hypothetical protein Sputw3181_1105 [Shewanella sp. W3-18-1]
MKFDVFLKSWQGTQLENRWQRFLIAVLVLSNLLLAVAAFSRNTVVAIQPPTLSETAEVSRNQATQPYLES
WGLYLAELMGNVTPGNVSFIRVAIEPLLSPAVYQQVVDALEIQARQIREDRVTLKFQPRQVEYEYETGHV
FVTGYSLVSGPSGDEQRQTRTYEFDIDIEQYRPKLSWMDTYEGQARTKRVREKLTQEQNRRVNDANQN
 
Nucleotide Sequence: 627 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1254508-1255134 Shewanella sp. W3-18-1 chromosome, complete genome
GTGAAGTTCGACGTGTTTTTAAAATCATGGCAAGGCACGCAATTAGAGAACCGATGGCAACGGTTCCTGA
TTGCAGTGCTGGTGCTATCTAACTTGCTGCTTGCGGTAGCGGCATTTTCTCGCAATACCGTGGTAGCCAT
TCAACCGCCAACCTTGTCTGAAACGGCTGAAGTGTCACGAAACCAGGCTACTCAGCCTTACTTGGAATCC
TGGGGGCTCTACCTGGCTGAGCTTATGGGCAACGTGACGCCGGGTAATGTGTCTTTTATCCGGGTTGCTA
TTGAGCCGCTACTTTCTCCAGCGGTGTACCAGCAAGTGGTCGATGCACTGGAGATTCAGGCAAGACAAAT
CCGGGAAGACCGAGTCACGCTCAAATTCCAACCCAGACAAGTGGAGTATGAGTATGAAACCGGCCATGTC
TTTGTGACCGGTTATTCCTTGGTCTCTGGACCATCTGGAGATGAACAGCGCCAAACTCGCACCTATGAGT
TTGACATCGATATTGAGCAATACCGTCCAAAGCTCAGTTGGATGGATACGTATGAGGGGCAAGCTAGAAC
GAAGCGAGTTCGTGAAAAGTTGACCCAAGAGCAAAACCGGAGGGTGAATGATGCGAACCAAAATTAG
 Primer design