SecReT4
Protein ID: 120597936
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1106
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1255115..1256014 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDA1RH11
KEGG IDshw:Sputw3181_1106
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.5e-18, Aligned region: 57..277
Protein Sequence: 299 a.a.     [Download]
>gi|120597936|ref|YP_962510.1| hypothetical protein Sputw3181_1106 [Shewanella sp. W3-18-1]
MMRTKISRWMIPSLIAMSLSGVLLSQASYADVELPIVPASVMKQSATANPPVQSNSVAADTPTMLLMTPG
VNELIPVALGHLNRIVTPFESPQVRTTSDAQTQIKGNVVYVATDKESPVSLYITPPGQEAPALSVTLVPR
RIPPREITLAIDGQQWPIKGVVNRKAATWETAQPYVDSLRDLLRRLALNELPQGYDIRLAGQTDTSPKCF
QPGLKFGFKQGQIVTGHYFTVYVGLVESFADEPIEASEIACNAPGIVASAYWPRNILLPGEKTELYVVVR
NHREEAVESQRPSLLVGGE
 
Nucleotide Sequence: 900 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1255115-1256014 Shewanella sp. W3-18-1 chromosome, complete genome
ATGATGCGAACCAAAATTAGTCGATGGATGATACCAAGCTTAATCGCAATGAGCTTGAGTGGCGTCCTGT
TATCTCAAGCTTCTTATGCAGACGTGGAATTGCCGATTGTACCAGCCAGTGTGATGAAGCAGTCTGCTAC
TGCAAATCCACCGGTTCAAAGCAATTCGGTTGCAGCGGATACGCCAACAATGCTACTGATGACACCGGGG
GTTAATGAACTGATCCCTGTAGCACTTGGTCATCTGAATCGGATTGTGACGCCGTTTGAATCGCCTCAGG
TGAGAACAACCAGTGATGCTCAGACGCAAATCAAGGGGAATGTTGTATATGTAGCCACGGACAAAGAATC
ACCGGTTTCACTTTACATCACTCCGCCTGGTCAGGAAGCTCCCGCATTATCTGTCACCTTAGTACCTCGT
CGTATTCCACCGCGTGAAATCACCTTAGCTATTGATGGTCAGCAGTGGCCTATTAAGGGCGTCGTGAACC
GAAAAGCCGCCACTTGGGAAACGGCTCAGCCATACGTCGATAGCTTACGTGATTTACTCAGACGCCTTGC
ACTAAATGAGTTACCACAAGGCTATGACATCCGTTTAGCTGGCCAAACTGACACAAGCCCGAAATGTTTT
CAGCCTGGCTTAAAGTTTGGTTTTAAACAGGGGCAAATTGTGACGGGACATTACTTCACCGTCTATGTAG
GACTGGTTGAAAGCTTTGCCGATGAGCCGATAGAAGCCAGTGAGATAGCCTGCAATGCACCAGGTATAGT
GGCAAGCGCCTACTGGCCTCGCAATATCTTGTTGCCGGGCGAAAAGACTGAGTTGTATGTGGTTGTTCGC
AATCATCGTGAAGAAGCGGTGGAAAGTCAGCGACCTTCGCTTCTTGTAGGAGGTGAATAA
 Primer design