SecReT4
Protein ID: 120597937
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1107
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1256017..1257306 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA1RH12
KEGG IDshw:Sputw3181_1107
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.4e-51, Aligned region: 212..416
Protein Sequence: 429 a.a.     [Download]
>gi|120597937|ref|YP_962511.1| TraB pilus assembly family protein [Shewanella sp. W3-18-1]
MKAQWEQLSPNMKRGLSVAGIAGGLILMVMVFSPNPDDGANSRNRQETIRHILTDTNTRDVGVDSLAANV
KLLSERNEQLRREVERLRRDVDSGRLSPGSPSIPSEVNAELVRLRAELNDVRAGGDAAVEGTNSRFEVPL
SAMELPKDEKPLPSNPDDYFANAPLPDPLYRQPASGQGSRARDVPLPPITIRMIEPEVVAEPEVVVQEAP
PLYLPAGSIISGTLITGLDAPTHESARREPFPALLRIQKEAILPNRFRADIKECFLIAAGYGDLSSERAY
LRGETISCVREDGGVIETRLDSYAVGEDGKAGIRGRLVSKQGQLVAKSMMAGFLQGLAGAFDVNPVPTIQ
TGNAGDTQLYQQVMSQEALQGAAIKGTGKALDRVAKFYLDMAENMFPVIEVDAARKIEVIVTRGASLSLA
TSQGGGARR
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1256017-1257306 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAGCACAATGGGAGCAATTGAGCCCGAACATGAAGCGGGGCCTATCGGTTGCAGGTATTGCTGGTG
GTCTCATCCTTATGGTGATGGTGTTTTCACCTAATCCTGACGATGGCGCGAACAGTCGGAACCGGCAGGA
AACGATCCGGCACATTCTTACGGATACCAATACTCGTGATGTTGGGGTCGATAGTTTGGCTGCGAACGTA
AAACTACTCAGTGAGCGCAATGAACAGTTACGTCGTGAAGTTGAGCGCTTGCGTCGTGACGTCGATTCAG
GACGGCTAAGCCCAGGTTCGCCTTCTATACCAAGTGAGGTCAATGCGGAGTTGGTTCGCCTTCGAGCGGA
ACTTAATGATGTTCGCGCTGGAGGTGATGCAGCAGTTGAAGGCACAAATAGCCGTTTTGAAGTGCCTTTA
TCTGCCATGGAATTGCCTAAAGACGAAAAGCCACTGCCGTCTAACCCAGACGACTATTTTGCCAATGCGC
CGCTGCCAGATCCGCTCTATCGGCAGCCAGCCAGTGGCCAAGGTTCACGAGCACGGGATGTTCCATTGCC
GCCAATCACGATTCGTATGATTGAGCCTGAAGTGGTTGCTGAACCAGAGGTTGTTGTGCAAGAAGCGCCG
CCTTTGTATTTACCGGCGGGCAGCATCATCTCAGGTACTTTGATCACAGGTTTGGATGCACCTACTCACG
AGTCCGCAAGACGCGAACCTTTTCCTGCATTGCTGAGGATTCAAAAGGAAGCCATTTTACCCAACCGATT
TAGAGCGGATATCAAAGAGTGTTTCTTGATCGCCGCAGGTTACGGTGATTTGAGCTCTGAGCGTGCTTAT
TTGCGAGGCGAGACCATTTCATGTGTGAGAGAAGACGGTGGCGTCATTGAAACACGACTGGATTCTTATG
CTGTAGGTGAAGACGGCAAAGCCGGCATTCGTGGCCGATTGGTGTCGAAACAAGGCCAGCTGGTGGCCAA
GTCGATGATGGCCGGATTCCTTCAGGGCTTGGCTGGCGCATTTGATGTAAATCCTGTTCCGACGATTCAG
ACGGGTAATGCCGGTGATACTCAGCTGTACCAGCAAGTCATGAGCCAAGAAGCATTACAAGGCGCTGCGA
TTAAAGGCACAGGTAAAGCATTGGATAGAGTGGCCAAGTTCTATTTGGACATGGCTGAAAATATGTTCCC
AGTCATAGAGGTAGACGCTGCAAGGAAAATTGAAGTCATAGTCACTCGTGGTGCCTCGTTGTCGTTGGCC
ACTTCTCAAGGGGGTGGTGCAAGAAGATGA
 Primer design