SecReT4
Protein ID: 120597938
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1108
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1257303..1257953 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDA1RH13
KEGG IDshw:Sputw3181_1108
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 5e-20, Aligned region: 67..173
Protein Sequence: 216 a.a.     [Download]
>gi|120597938|ref|YP_962512.1| hypothetical protein Sputw3181_1108 [Shewanella sp. W3-18-1]
MKKSCMLLTDRSPFQTIRCVSRGELTMTTSMQNNPKHQSKQWSKAGLLLLAVGSTLLSGCSSLGLGSSEY
GCPGMPDGVRCLSAREVYELTSYGAAPKTIDAVATRIGSPSGYSQSDLETGLLSHPALPETQQSAPIRIP
SRVMRIWIAPWEDDRGDLNLSSYVFTEIEPRRWDIGVSAPRTVSPVLRPLQTQSDSASAGADGKRDNLSI
YGETNE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1257303-1257953 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAAAATCCTGCATGTTGCTAACCGATCGAAGTCCGTTTCAGACAATAAGATGTGTATCCAGAGGAG
AGTTAACCATGACGACATCAATGCAGAACAACCCAAAGCACCAGTCAAAACAGTGGTCTAAAGCTGGATT
ACTTTTATTGGCAGTCGGCTCAACCTTATTGTCTGGCTGTAGTTCATTGGGTCTTGGGAGTAGTGAATAT
GGATGCCCAGGTATGCCTGACGGTGTGCGCTGTTTATCTGCTCGTGAAGTCTATGAGCTTACCAGTTATG
GCGCTGCACCCAAGACGATTGATGCTGTGGCGACTCGAATTGGTTCTCCCTCTGGGTATTCACAATCTGA
TTTAGAGACAGGACTGCTGAGCCATCCAGCATTACCCGAGACGCAGCAATCTGCACCTATTCGCATTCCT
TCAAGGGTAATGCGGATTTGGATTGCGCCTTGGGAGGATGACCGTGGAGATCTGAATTTATCCAGCTACG
TGTTTACCGAAATTGAACCGCGCCGGTGGGATATTGGGGTGTCAGCACCTCGAACGGTTTCGCCAGTGCT
ACGTCCACTTCAGACTCAAAGCGATTCAGCCTCAGCGGGAGCTGATGGTAAGCGCGATAACTTGAGTATC
TACGGAGAAACTAACGAATGA
 Primer design