SecReT4
Protein ID: 120597939
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1109
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1257950..1258339 [+]
Producthypothetical protein
Component typeTraA_F
UniProt IDA1RH14
KEGG IDshw:Sputw3181_1109
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.3e-06, Aligned region: 8..92
Protein Sequence: 129 a.a.     [Download]
>gi|120597939|ref|YP_962513.1| hypothetical protein Sputw3181_1109 [Shewanella sp. W3-18-1]
MTNAVRSIQTQRLMTIGALGLMALMISEPSFAGTGGDAFTDVWDTLKDWTQGTLGRIVAGAMVLVGIVGG
IARQSLMAFALGIGGGMGLYNTPTVVESVMSATLPVVASTQEVIGTTIPAISAVLLGTL
 
Nucleotide Sequence: 390 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1257950-1258339 Shewanella sp. W3-18-1 chromosome, complete genome
ATGACAAATGCAGTTCGCAGCATTCAGACTCAGCGCCTAATGACCATTGGTGCGCTTGGTTTAATGGCGT
TAATGATTTCGGAGCCCTCATTTGCAGGCACCGGTGGTGATGCTTTCACCGATGTGTGGGATACCCTAAA
AGATTGGACCCAAGGTACTTTGGGACGGATCGTAGCGGGAGCCATGGTTCTGGTGGGTATTGTGGGCGGT
ATCGCTCGCCAAAGCTTGATGGCCTTTGCCTTGGGCATTGGTGGCGGTATGGGTCTCTACAACACACCAA
CAGTCGTTGAAAGTGTCATGTCTGCAACTTTACCTGTTGTTGCTAGCACTCAAGAAGTCATTGGCACAAC
AATTCCAGCAATCAGCGCCGTTTTACTGGGCACCTTATAA
 Primer design