SecReT4
Protein ID: 120597963
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1140
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1288318..1290717 [+]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDA1RH38
KEGG IDshw:Sputw3181_1140
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.8e-57, Aligned region: 437..713
TraC_F_IV [PF11130], Evalue: 4.2e-54, Aligned region: 9..242
Protein Sequence: 799 a.a.     [Download]
>gi|120597963|ref|YP_962537.1| sex pilus assembly protein [Shewanella sp. W3-18-1]
MKASLYSGQRASELLPVLAYSDDEQLFFMEDQSVGFGFLCDPLPGGDESVADRVNVLLNNDWPKDTLLQF
GLYASPDIQTDLQRMMGLRHRQSDPLLRASIRKRADFLDGGTVQPIEESTQTQVRNFQLIVTCKLPLESP
IPTERELSRASAIRASFSQALATVGFRVTEMTDRNWLAALSSQLNWGKDASWRNPSPIRSEADKPLREQV
LDYDRAIKVDSQGLMLGDYRVKTLSFKRLPERIWFGHAASFAGDMMTGSRGLRGSFLLNVTIHFPSAEAM
RSRLETKRQWAVNQAYGPMLKFVPVLAAKKKGFDVLFEALQEGDRPIRANMTLTLFSQTEEASISSVSNA
RTYFKELGFELMEDKYFCLPIFLNALPFGADRQAMNDLFRFKTMATRHVIPLLPLFADWKGTGTPVINFV
SRNGQIMSVSLYDSGSNYNCCIAAQSGSGKSFLVNEIISSYLSEGGQCWVIDVGRSYEKLCEVYDGEFLQ
FGRDSGICLNPFEIVEDYDEEADVLVGLLAAMAAPTQSLTDFQMANLKRQTRELWEKKGRAMLVDDVAEA
LKNHEDRRVQDVGEQLYPFTTQGEYGRFFNGHNNIRFKNRFTVLELEELKGRKHLQQVVLLQLIYQIQQE
MYLGERDRRKIVFIDEAWDLLTQGDVGKFIETGYRRFRKYGGSAVTVTQSVNDLYDSPTGKAIAENSANM
YLLGQKAETINALKKEGRLPLGEGGYEYLKTVHTVTGVYSEIFFITEMGTGIGRLIVDPFHKLLYSSRAE
DVNAIKQLTRKGLSVADAISQLLKERGYE
 
Nucleotide Sequence: 2400 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1288318-1290717 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAGCCTCTCTGTATTCAGGGCAACGCGCTTCAGAGCTGTTGCCAGTATTGGCCTATTCAGACGATG
AGCAACTGTTTTTCATGGAAGACCAGAGTGTTGGCTTTGGTTTTCTATGTGACCCATTGCCGGGTGGTGA
TGAGTCTGTTGCAGATAGGGTTAATGTTCTACTCAACAACGACTGGCCAAAAGACACTTTGCTGCAATTT
GGCCTGTACGCCTCGCCTGATATTCAAACCGACCTTCAACGCATGATGGGCTTACGGCATCGTCAATCCG
ATCCATTGCTCAGGGCGTCGATACGCAAACGTGCGGATTTCCTCGATGGGGGCACGGTTCAACCGATAGA
AGAATCGACCCAGACTCAGGTACGCAACTTTCAACTGATCGTCACCTGCAAATTGCCTTTGGAAAGTCCT
ATACCGACGGAGCGTGAGTTGAGTCGAGCATCCGCGATTCGGGCTTCTTTCTCGCAAGCGCTGGCAACGG
TTGGTTTTCGCGTCACTGAGATGACTGACCGAAATTGGCTCGCGGCATTAAGTTCGCAACTTAACTGGGG
AAAAGATGCTTCTTGGCGCAATCCATCTCCAATCCGCAGTGAGGCAGATAAACCACTTCGAGAGCAAGTG
TTGGATTATGACCGAGCTATCAAGGTGGATAGCCAAGGTCTGATGCTGGGCGATTACCGAGTTAAAACCT
TATCGTTTAAGCGCTTGCCTGAGCGGATCTGGTTTGGTCATGCCGCAAGTTTTGCGGGCGATATGATGAC
GGGCAGTCGCGGTTTACGCGGCAGCTTTTTGCTGAATGTCACCATTCACTTTCCTTCAGCCGAGGCCATG
CGATCTCGTTTAGAGACGAAGCGTCAATGGGCGGTCAATCAGGCCTATGGCCCGATGCTCAAGTTTGTGC
CGGTGCTTGCAGCCAAGAAAAAGGGATTTGATGTTCTTTTTGAAGCCTTGCAAGAAGGTGATCGTCCTAT
TCGGGCAAACATGACCTTAACGCTGTTTTCCCAAACGGAAGAAGCGTCCATCAGCTCTGTTTCAAATGCT
CGAACTTATTTCAAAGAACTCGGATTTGAGCTGATGGAAGACAAGTACTTCTGTTTGCCCATTTTTCTGA
ATGCCCTGCCATTTGGTGCCGACCGCCAGGCGATGAACGACTTGTTTCGATTCAAGACCATGGCGACACG
GCATGTGATCCCTCTGTTGCCTTTGTTTGCGGATTGGAAAGGCACGGGCACGCCAGTGATTAACTTTGTT
TCCCGTAATGGCCAGATCATGAGTGTGTCCCTTTATGACTCGGGCAGTAATTACAACTGTTGCATCGCGG
CGCAATCGGGGTCGGGTAAGTCATTCCTGGTGAACGAAATCATCTCCTCCTACTTATCTGAAGGCGGCCA
ATGCTGGGTGATTGATGTTGGCCGCTCTTATGAAAAGCTGTGTGAAGTCTATGACGGTGAGTTCTTACAG
TTCGGGCGGGACAGTGGCATTTGCTTGAATCCGTTTGAAATTGTTGAGGACTATGACGAAGAAGCGGATG
TGCTGGTTGGGCTATTGGCTGCAATGGCCGCACCTACGCAGTCATTAACTGATTTTCAGATGGCCAACCT
AAAGCGTCAGACCCGTGAACTTTGGGAGAAAAAAGGTCGTGCCATGTTGGTTGATGATGTGGCTGAGGCC
TTAAAAAATCATGAAGACCGTCGTGTGCAAGACGTGGGTGAGCAGCTCTATCCGTTTACGACACAGGGCG
AATATGGCCGTTTCTTTAATGGTCACAACAATATTCGTTTCAAAAACCGTTTCACTGTTCTGGAGTTAGA
AGAGCTCAAGGGGCGCAAGCACCTACAACAAGTGGTGTTGCTTCAGCTTATCTACCAAATCCAACAAGAG
ATGTACTTAGGTGAGCGGGATCGTCGCAAGATTGTGTTCATTGACGAAGCCTGGGATCTGCTGACTCAAG
GTGATGTCGGTAAGTTTATCGAGACGGGTTACCGTCGATTTCGAAAATATGGCGGCAGTGCTGTAACGGT
AACGCAGTCGGTCAACGATTTATACGACAGCCCTACAGGTAAAGCCATCGCTGAAAACTCGGCCAATATG
TACCTGCTTGGCCAAAAAGCTGAAACCATCAACGCGCTCAAAAAAGAAGGCCGCTTGCCACTCGGTGAAG
GCGGTTATGAATACCTGAAAACCGTTCATACCGTCACTGGTGTCTATTCCGAAATTTTCTTTATTACCGA
GATGGGCACCGGGATTGGCCGCCTCATCGTCGATCCGTTTCACAAGCTGTTGTACTCGTCCCGTGCAGAA
GATGTAAACGCGATTAAGCAGTTAACGCGTAAAGGCCTTTCTGTTGCTGATGCCATCTCCCAGTTGTTAA
AGGAGCGAGGCTATGAATAA
 Primer design