SecReT4
Protein ID: 120597966
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1143
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1291564..1292688 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDA1RH41
KEGG IDshw:Sputw3181_1143
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.5e-23, Aligned region: 73..189
Protein Sequence: 374 a.a.     [Download]
>gi|120597966|ref|YP_962540.1| hypothetical protein Sputw3181_1143 [Shewanella sp. W3-18-1]
MRRLYLLFLLVAPLAWVQVSWAQEPYPLSDEDKKIVEMSRSILQSAVDGSSEFIEPFSPIEQPASLKNND
EWLIFASSSLGDSSLKQLFKEASATGAIVLFRGIPEGKNLGAAIRDWHTLMVGLDPVPQVRIDPKAFVHW
RVTSVPAIFRIEDDKVTASALGVYSKDWLQRQIEKGNTGSLGQRGPIHSILEPDLMQVAMQRLQSIDLGA
LKKKAIERFWSRQTFTELPKATQYRIRMVDPTIVMQRSLLDASGRTLIPAGTRINPLKALPFTQQLVVFN
ASNAEEVDAVAHWLETQDRTLRRITLITTQLDRAQGWNRLNALEKTLDSPVYLLNGSLKQRFDLQVTPSF
VQAKGLAFEIEEIPAKELVHEKAQ
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1291564-1292688 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAGAAGACTATACCTCTTATTTTTGTTGGTTGCGCCATTGGCTTGGGTTCAAGTGTCCTGGGCACAAG
AGCCTTATCCGTTGTCTGACGAGGACAAAAAGATCGTCGAAATGAGCCGCAGCATTTTACAAAGTGCTGT
GGATGGTTCATCTGAATTTATCGAGCCTTTTTCACCGATTGAACAACCTGCGTCGCTCAAAAACAACGAT
GAATGGTTGATATTTGCGTCGTCCTCACTGGGAGATTCCTCACTGAAGCAGCTATTTAAAGAGGCCAGTG
CTACCGGCGCTATTGTGTTGTTTCGGGGAATTCCTGAAGGAAAGAACTTGGGGGCGGCTATCCGTGATTG
GCATACGCTGATGGTGGGACTTGATCCTGTTCCTCAGGTTCGAATCGATCCGAAAGCCTTTGTGCACTGG
CGGGTGACTAGCGTGCCTGCCATTTTCCGCATAGAAGATGACAAGGTGACTGCAAGTGCACTAGGGGTTT
ACAGCAAGGACTGGTTGCAGCGTCAAATTGAAAAAGGCAATACCGGTTCATTGGGTCAACGCGGTCCTAT
TCATTCCATTTTAGAACCGGATTTGATGCAAGTGGCGATGCAGCGTTTACAGTCGATTGACTTGGGCGCG
TTAAAGAAAAAAGCCATTGAGCGATTCTGGTCTCGCCAAACTTTCACTGAGTTACCCAAAGCCACGCAGT
ATCGGATAAGAATGGTTGATCCAACCATCGTCATGCAGCGGTCACTATTGGATGCCAGTGGCCGAACATT
GATCCCAGCAGGAACGCGTATTAACCCGCTAAAAGCCTTGCCGTTTACTCAGCAGCTTGTGGTGTTTAAT
GCGTCGAACGCTGAAGAAGTGGACGCAGTAGCGCATTGGCTTGAGACGCAAGATAGGACACTGCGCCGCA
TTACGCTTATCACCACGCAGCTCGACCGTGCCCAAGGCTGGAATCGCCTCAATGCGCTCGAAAAGACATT
GGACAGTCCGGTTTACCTTCTCAATGGCTCGCTAAAGCAGCGCTTTGATTTGCAAGTCACCCCGTCGTTT
GTTCAAGCAAAGGGGCTCGCGTTTGAAATAGAAGAAATTCCAGCAAAGGAGCTTGTTCATGAAAAAGCTC
AATAA
 Primer design