SecReT4
Protein ID: 120597967
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1144
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1292672..1293700 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDA1RH42
KEGG IDshw:Sputw3181_1144
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.5e-70, Aligned region: 43..339
Protein Sequence: 342 a.a.     [Download]
>gi|120597967|ref|YP_962541.1| TraU family protein [Shewanella sp. W3-18-1]
MKKLNNTYRLLRTLIVMFVLGASIPAKAELTCPDAGLLSGKLLTDVCWSCIFPIRVAGLPLGSGSVPSGA
SNKSFCLCEDNLGVPRPGIVTSMWEPARLIELVRTPGCSPSLGGIRLPLGDRRLQGGHGEGEYDTGDLAF
YHYHYYAFPLLVMLDLFMDGNCNADGYMDFDLMYLSELDPTWMNDELAFFTQPEAAAVANPLAISACTAD
AASSTLGKPIDQLFWCAGSWGHLYPLSGHTLAFGSLAENTSHLAARAIAAQHRRGLARRTMGNSALCRPV
IEPMLPKSQYKMSMFFPVPETESAHVIGESTMKWGEWRTIPGAGEDALYILWRWQDCCNSGG
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1292672-1293700 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAAAGCTCAATAATACGTATCGTCTGTTGCGGACTCTCATTGTCATGTTTGTCCTTGGCGCATCTA
TTCCTGCAAAAGCCGAACTGACCTGCCCAGACGCGGGTTTATTGTCGGGTAAGTTGCTGACGGATGTTTG
CTGGTCATGCATTTTTCCTATCCGAGTTGCGGGTCTTCCTCTTGGCTCTGGCAGTGTCCCAAGCGGCGCA
TCAAACAAGTCATTTTGCTTATGTGAAGATAACTTAGGCGTGCCAAGGCCAGGTATTGTTACCAGCATGT
GGGAGCCAGCGCGTTTAATTGAACTGGTCAGAACGCCGGGTTGCTCGCCTTCCCTGGGAGGGATTCGTTT
ACCGTTAGGTGATAGGCGGCTGCAAGGTGGTCATGGCGAGGGTGAATACGATACCGGTGATCTCGCTTTC
TACCATTACCATTATTACGCCTTTCCGCTTTTGGTCATGCTCGATTTGTTCATGGATGGCAATTGCAATG
CCGATGGTTACATGGACTTTGACTTGATGTATTTGTCCGAATTGGACCCCACATGGATGAACGATGAACT
GGCCTTTTTTACTCAGCCTGAAGCTGCTGCCGTTGCCAATCCATTGGCTATATCTGCTTGTACCGCTGAC
GCTGCTTCATCAACGCTTGGTAAACCCATCGATCAGTTGTTTTGGTGTGCTGGCAGTTGGGGCCATCTCT
ATCCCTTATCTGGCCACACCTTAGCCTTTGGCTCATTAGCAGAAAACACCAGCCATTTAGCAGCGCGAGC
AATCGCGGCTCAACACAGGCGTGGTCTTGCAAGGCGAACAATGGGGAACAGTGCGCTATGCCGACCTGTT
ATCGAACCCATGCTGCCGAAATCCCAATACAAGATGAGTATGTTCTTCCCTGTACCGGAAACTGAAAGTG
CGCATGTCATCGGTGAAAGCACCATGAAATGGGGAGAGTGGCGAACGATCCCCGGTGCCGGTGAAGATGC
GCTCTACATTTTGTGGCGCTGGCAAGACTGCTGTAACTCGGGAGGTTAA
 Primer design