SecReT4
Protein ID: 120597968
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1145
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1293703..1297395 [+]
Productmating pair stabilisation TraN
Component typeTraN_F
UniProt IDA1RH43
KEGG IDshw:Sputw3181_1145
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.2e-86, Aligned region: 373..462
TraN [PF06986], Evalue: 1.2e-86, Aligned region: 740..1005
TraN [PF06986], Evalue: 1.2e-86, Aligned region: 1072..1148
Protein Sequence: 1230 a.a.     [Download]
>gi|120597968|ref|YP_962542.1| mating pair stabilisation TraN [Shewanella sp. W3-18-1]
MKPTLFTRVLAGILSITMACLPLHGVAADVQRQSGLSGQQEGKQLLQNWTMPALNGNTLSVPNGSGNESI
NLQELFPGMDQGSLDVLTGVYGSDASMNQMGTQRQESMASESGATGEAFRSLQQIKDRSRPDMVNDPLWA
LTDAVQTAPNLLTQSFPGCESQGEGSPNYQQCDRLNTAVNSCTITHDYTAGIIEHVSGPMNLRSCGEGCL
EVWIGRIGDNYWSGRCKVFEQAITLKVVNPDAITSAVLEYAKWDDYMQVWLGDQKVWSGPNNNFPPETAG
RCELSTSWERNPNTDLTARLKAVEPGLEVPVKIRVSVTGSGEGYARIKVRFDPTKVVMNDSWSPQSCIEQ
AADIPTKFSDYSIQCTDQPSSTNGCTVVNGVSVCESYFAPSPVAGISPLCRRVQVSVDDESYKGIENQAC
QVLEANPSCGFMSSECAETNDKGECIRFTDTYDCGLQTSDPKCVVSNLMPSSFEACEPTQTITPFTETKH
VPDYQVCEKISTLTECQLERRISAQTHQQSWSIERGCFSSETLSFVPQHSSTMQTGNATLRVFDNQNTEI
KITESPSKANGWKTTLSLTGNKETVTETKPSIKYPEMTCPKGTLVGSLCKVVNGSIISWHEPQEVTRSRC
ESGWNKVDFDTCSREVQKCLAPAKLSASLTFSGKYLEQDVVHQSSDPGIDQCLMQTDQFTAVQWQCLDTG
TKRIDGLTVGSGELANLGSLYPAVVSSPVHLTSRGSSDGLGLSCWRARATYNASTAHPEFNMGSSDSWVD
ANGNTQTIVNNGQNTTTNTCAALEQNLACQYVRTECTEGGAGHEGFCYIQSLVYDCGQSVEVQNARMETQ
YNCEGPVRCMGTDCLEPESIKQANFAEAAAMLNAAQFMTNDMSCTGADGQDNVECTVFKGNAGQCKKAVG
GIVDCCEKPSGVSLSDYITMIVAVNKLDTAVMAMNPSSAIYGSWNTLREPITSTWSAVQEPFVSAWDSLM
GAGPSTAAGAGAEQAATGFMQVLTNKTAEWVGSTFGSGAQSALFSNVGGAVGADGVVSGGNFALGGAAGA
VLSTVMTAYMIYSVTMILIQLIWKCEQSEFEMNAKRVLKSCHYVGSYCKSKFLGACVEKRQSYCCFTSPL
SRIIQEQVRPQLGLGWGSAKSPNCEGLTASQLNQVDWSQVNLDEWIGILSITGNLPEVPSLDLERLTGSG
STLNVDGNRQSAADRAIERLNGMDAQKLRQEATEEISGNN
 
Nucleotide Sequence: 3693 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1293703-1297395 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAACCAACACTTTTTACCCGAGTTTTAGCGGGTATTTTATCAATCACTATGGCGTGCCTGCCCTTAC
ATGGTGTGGCCGCTGATGTGCAGCGCCAATCCGGCCTAAGCGGACAACAAGAAGGTAAGCAATTGCTGCA
AAACTGGACGATGCCCGCACTCAATGGCAATACATTGTCGGTGCCGAATGGCAGTGGTAATGAGTCCATT
AACTTGCAAGAGCTTTTCCCTGGTATGGATCAGGGCTCATTGGATGTCTTAACGGGCGTTTATGGCTCTG
ATGCCAGCATGAATCAAATGGGGACACAGCGCCAAGAGAGCATGGCATCCGAAAGTGGCGCTACGGGTGA
GGCGTTTCGTTCGCTACAGCAAATCAAAGACAGGTCTCGGCCAGATATGGTCAATGATCCGCTTTGGGCA
TTAACTGATGCGGTTCAAACTGCCCCCAATCTATTAACGCAAAGCTTCCCCGGCTGTGAGTCTCAAGGTG
AAGGTAGCCCAAATTACCAGCAATGCGACAGGCTCAATACAGCGGTTAACAGCTGCACTATTACTCACGA
TTACACGGCAGGCATTATTGAGCATGTTTCAGGACCAATGAACCTTCGCTCTTGTGGTGAGGGATGTCTT
GAAGTTTGGATTGGACGAATTGGCGACAACTACTGGAGTGGCCGTTGTAAAGTGTTTGAACAGGCCATCA
CACTCAAAGTCGTGAACCCCGATGCGATTACTTCAGCCGTTCTTGAGTACGCCAAATGGGATGACTACAT
GCAGGTGTGGCTTGGCGATCAGAAAGTCTGGTCTGGGCCGAACAATAACTTTCCACCAGAAACGGCAGGT
CGCTGCGAGCTCAGTACCAGTTGGGAGCGCAATCCAAATACCGATCTCACTGCCAGGCTAAAAGCGGTAG
AACCAGGTTTAGAAGTGCCGGTAAAAATTCGCGTATCGGTCACTGGTAGTGGTGAGGGGTATGCACGCAT
CAAGGTGCGCTTTGATCCAACCAAGGTGGTGATGAATGATAGTTGGTCGCCACAATCCTGTATCGAACAA
GCAGCGGATATCCCGACGAAGTTTTCAGACTACAGCATTCAATGCACGGATCAGCCTTCTTCAACCAACG
GATGTACGGTGGTCAATGGTGTTTCAGTTTGTGAATCCTACTTTGCCCCAAGCCCAGTGGCTGGCATATC
GCCTTTGTGTCGGCGTGTTCAAGTTAGTGTGGATGATGAAAGCTATAAGGGGATTGAAAATCAGGCCTGC
CAAGTGCTTGAAGCGAATCCTTCCTGTGGATTCATGTCGTCAGAATGTGCCGAGACCAATGATAAAGGTG
AATGCATTCGTTTTACCGATACCTATGACTGTGGATTGCAAACCAGCGATCCAAAGTGTGTGGTATCCAA
CCTTATGCCAAGTAGTTTTGAAGCTTGTGAGCCTACTCAGACGATTACGCCATTTACTGAAACCAAGCAT
GTACCGGATTACCAGGTGTGCGAGAAGATCAGCACGCTTACTGAGTGTCAGTTAGAACGACGTATATCCG
CCCAAACCCATCAACAAAGCTGGTCCATTGAGCGTGGTTGCTTTAGCTCCGAAACGCTCAGTTTTGTTCC
ACAGCACAGCAGCACTATGCAAACTGGAAACGCGACGCTGAGAGTGTTTGATAATCAAAATACTGAGATA
AAAATCACCGAGTCGCCGTCCAAGGCAAATGGCTGGAAAACGACACTCTCATTGACGGGCAACAAGGAGA
CGGTCACAGAGACGAAACCGTCCATTAAATACCCTGAAATGACCTGTCCAAAAGGAACCTTAGTTGGTTC
ATTGTGTAAGGTCGTTAATGGGTCGATTATTTCGTGGCATGAACCTCAGGAAGTTACTCGTTCCAGATGT
GAATCCGGCTGGAACAAAGTCGATTTCGATACTTGCAGCCGAGAAGTTCAGAAGTGTTTGGCTCCTGCGA
AACTGAGCGCTTCATTGACCTTCTCTGGCAAGTACTTAGAACAGGACGTTGTTCATCAATCAAGTGATCC
GGGCATAGACCAATGCTTGATGCAAACGGATCAGTTTACTGCCGTGCAGTGGCAGTGTTTGGATACGGGC
ACAAAACGAATCGACGGGTTAACGGTTGGTAGTGGCGAGTTGGCCAATCTTGGGAGCCTTTATCCAGCGG
TTGTTTCGTCTCCTGTTCATTTAACCAGTCGCGGCAGCTCTGATGGACTGGGACTCTCATGCTGGAGGGC
AAGAGCAACCTACAATGCTTCGACTGCTCATCCAGAGTTCAACATGGGCAGCTCAGATAGCTGGGTAGAT
GCCAATGGTAATACACAAACCATCGTTAATAACGGACAAAACACGACCACCAATACGTGTGCCGCGCTGG
AGCAAAACCTGGCCTGCCAGTACGTCAGAACCGAATGCACTGAAGGCGGGGCTGGTCATGAAGGCTTCTG
CTATATCCAAAGTTTGGTGTATGACTGCGGACAAAGCGTTGAAGTGCAAAATGCACGAATGGAAACTCAA
TACAACTGTGAGGGGCCAGTTCGCTGTATGGGCACAGATTGTTTAGAGCCAGAGTCAATCAAGCAGGCTA
ACTTTGCAGAAGCCGCAGCGATGCTTAATGCGGCGCAGTTTATGACCAATGATATGTCATGTACGGGAGC
TGATGGCCAAGATAACGTCGAGTGTACGGTCTTTAAAGGTAATGCTGGCCAGTGCAAAAAAGCCGTTGGT
GGCATAGTGGATTGCTGTGAAAAGCCAAGTGGCGTGTCGTTATCGGACTACATCACGATGATAGTGGCGG
TTAACAAGCTTGATACGGCAGTCATGGCTATGAATCCGTCTTCGGCAATCTATGGTTCCTGGAATACGCT
TAGGGAGCCAATCACGAGTACTTGGAGTGCGGTCCAAGAGCCTTTTGTGTCTGCATGGGACTCTCTCATG
GGGGCTGGGCCATCAACGGCTGCTGGCGCGGGAGCGGAGCAAGCTGCGACTGGCTTCATGCAGGTGTTGA
CCAACAAAACGGCTGAATGGGTAGGCTCTACCTTTGGTTCGGGGGCGCAATCGGCACTGTTTAGTAACGT
TGGTGGTGCTGTCGGAGCCGATGGTGTTGTTTCGGGCGGCAACTTTGCGCTGGGTGGCGCTGCGGGCGCG
GTTCTGAGTACGGTTATGACGGCCTACATGATTTATTCAGTCACCATGATCCTCATTCAGCTTATCTGGA
AATGTGAGCAGAGTGAGTTTGAAATGAACGCCAAGCGGGTATTGAAGAGTTGCCACTATGTAGGCTCTTA
CTGCAAGTCTAAGTTCTTAGGTGCCTGTGTTGAAAAACGGCAGTCATATTGCTGCTTTACTTCGCCACTT
TCACGGATCATTCAAGAACAAGTACGTCCTCAATTGGGCCTTGGTTGGGGCAGTGCGAAATCTCCCAACT
GTGAAGGATTGACCGCGAGTCAGTTAAACCAGGTGGATTGGAGCCAAGTCAATCTGGATGAATGGATAGG
TATCTTATCGATAACAGGCAACCTACCCGAAGTACCGTCACTGGATTTGGAACGACTCACAGGCTCAGGA
AGTACGCTAAACGTTGATGGAAACCGTCAAAGTGCCGCAGATAGAGCTATTGAAAGGCTAAACGGAATGG
ATGCCCAGAAACTGCGTCAGGAGGCGACGGAAGAAATTTCGGGGAATAATTGA
 Primer design