SecReT4
Protein ID: 120597996
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1173
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1323458..1324402 [+]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDA1RH71
KEGG IDshw:Sputw3181_1173
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.6e-72, Aligned region: 41..260
Protein Sequence: 314 a.a.     [Download]
>gi|120597996|ref|YP_962570.1| sex pilus assembly protein [Shewanella sp. W3-18-1]
MRTPLLPWFILWVTIPIIIFFLFILPAYASDEPFYQRGQEGWFWYQVIPGPAEAEELIKPESGAAESSKS
GLKPFSAAWFREHMQSFMDKAIDEPTNENVRAYLYLQRVMMDKGSQFADVSQQVVMGDPVLDEISRRPLA
TYAANRMDREAGAQRDIALGEVAKRAGLFFFYRSDCPYCHAQAPIIESMALNYGFEVFAIAVDGLPLPGG
EFPHYKVDSGQAQSLSVTTVPAVFLVDPPNVITPIGQGAMSLDELNNRIILAAHQAGWIDDQTYYATRPV
QPGVSLAMSAQELNEKILQDPEFLVRYLRAQGGL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1323458-1324402 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAGAACGCCTTTGTTACCTTGGTTTATCCTATGGGTGACCATCCCAATCATTATTTTCTTTCTATTCA
TCTTACCCGCCTATGCCAGTGACGAGCCATTCTATCAGCGTGGTCAGGAAGGCTGGTTTTGGTATCAGGT
CATTCCTGGGCCAGCGGAGGCTGAAGAGCTTATTAAGCCGGAATCTGGTGCGGCAGAGTCGAGTAAGAGC
GGGCTAAAGCCTTTCAGTGCTGCCTGGTTTCGTGAGCACATGCAGTCGTTCATGGACAAGGCAATTGATG
AGCCGACGAATGAGAACGTCAGAGCCTATCTGTATCTCCAGCGCGTCATGATGGATAAGGGCTCACAGTT
TGCTGATGTTAGTCAGCAGGTAGTCATGGGCGATCCAGTTTTGGATGAAATCAGTCGCAGACCCTTGGCT
ACCTATGCTGCCAATCGGATGGATCGAGAAGCTGGCGCTCAACGAGATATTGCTTTAGGTGAAGTAGCAA
AACGGGCTGGCTTATTCTTCTTCTATCGTTCTGATTGCCCTTACTGCCATGCTCAAGCGCCTATCATCGA
ATCAATGGCTTTGAACTATGGTTTCGAGGTGTTTGCTATTGCAGTCGATGGCTTGCCTTTACCTGGTGGA
GAGTTTCCTCATTACAAAGTCGATTCAGGACAAGCCCAATCCTTGTCCGTTACGACTGTTCCAGCGGTCT
TCTTAGTAGACCCGCCTAATGTCATCACTCCGATTGGCCAAGGTGCAATGAGCCTCGATGAGCTCAATAA
TCGAATCATTCTCGCAGCCCATCAAGCCGGTTGGATTGACGATCAAACTTACTATGCCACCAGACCTGTT
CAACCCGGCGTGTCACTCGCGATGTCAGCGCAAGAGCTTAACGAAAAAATATTACAGGACCCTGAGTTTC
TTGTTCGCTATCTGCGTGCACAAGGAGGGTTATAA
 Primer design