SecReT4
Protein ID: 120597997
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1174
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1324405..1325793 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDA1RH72
KEGG IDshw:Sputw3181_1174
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 7.7e-103, Aligned region: 28..389
Myb_Cef [PF11831], Evalue: 9.5e-06, Aligned region: 367..456
Protein Sequence: 462 a.a.     [Download]
>gi|120597997|ref|YP_962571.1| TraH family protein [Shewanella sp. W3-18-1]
MKKVFRVSLIACAIGFSSMSQASLQQEMNQLFGSMTNTTAPGVFESQRRGVISGGSVVVRNRIMNENLVS
MVPPSFQAGCGGIDMFAGSLSFVNADQFVQLLRSVAANAKGYAFQLALSAMCEKCSQHMETLQKKIQQLN
EYFGNSCQMAQGVVNDTLAAFGKKGQTEASMLSSLKGAGDVFTSWSESNGKNPYENASSVAASDVNKTIK
GNLVWRALKRHSASSWFASGDDRFLEAVMSVTGSIIVGDLANAADGQGKAPKLTRLNGNKVTIEHLIHGG
NVAMYRCDTVTQDGCLNPTITNVTLTGLSTQVENLLLGTGSSNGIIFKFARNTGAASTTEKAFMTSAPAS
IGGMIRTLSALNEGAARSFASRAAPFIAVEMARALVEDMLNAARSTSGVEDHAYAKLLTEDLERARRQIN
EEYAALQRRYGSEQELLAHFNQVIQTIRKQRYYTVKSTALGE
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1324405-1325793 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAAAAGTATTCCGAGTATCGCTTATCGCCTGTGCGATTGGTTTTTCATCTATGAGCCAAGCAAGCT
TGCAACAGGAGATGAATCAGTTGTTTGGTTCAATGACCAACACCACTGCGCCTGGTGTATTCGAGAGTCA
ACGACGTGGCGTTATATCTGGAGGAAGTGTTGTTGTTCGTAACAGGATCATGAATGAGAACCTCGTCTCT
ATGGTGCCACCGTCATTCCAAGCCGGTTGTGGCGGCATTGATATGTTCGCTGGAAGTTTGTCATTTGTTA
ATGCTGATCAGTTCGTTCAATTGCTTCGCTCTGTGGCGGCAAATGCCAAGGGATATGCATTCCAACTGGC
GCTCAGCGCTATGTGTGAGAAATGCTCACAGCACATGGAGACTCTGCAAAAGAAAATCCAGCAGTTGAAC
GAGTATTTTGGCAATTCCTGTCAAATGGCTCAGGGAGTCGTGAACGATACCTTGGCTGCTTTTGGTAAGA
AGGGGCAAACAGAAGCCAGCATGTTGAGCTCACTTAAAGGGGCTGGAGACGTTTTTACCAGTTGGAGTGA
GTCCAATGGTAAGAACCCTTATGAGAACGCTTCAAGTGTCGCGGCATCTGATGTGAACAAAACGATTAAA
GGCAACTTGGTTTGGCGAGCACTGAAACGTCACTCGGCATCAAGCTGGTTTGCATCGGGGGATGACCGTT
TTCTTGAAGCGGTTATGTCAGTGACTGGTTCGATCATTGTTGGTGATTTGGCTAATGCGGCTGATGGTCA
AGGTAAAGCCCCAAAACTGACCAGACTGAATGGCAATAAAGTGACTATTGAGCATCTAATTCATGGCGGT
AACGTCGCTATGTACCGATGTGACACAGTGACACAAGACGGCTGTCTGAATCCGACAATCACTAACGTGA
CCCTAACCGGGTTATCAACCCAGGTAGAAAATTTACTGCTTGGTACAGGTTCTAGTAACGGCATTATTTT
TAAGTTTGCTCGAAATACTGGGGCAGCTAGCACCACCGAAAAGGCTTTTATGACCTCGGCTCCTGCGAGC
ATTGGCGGCATGATTCGAACACTTTCTGCATTAAATGAAGGGGCTGCTAGGTCGTTTGCTTCAAGAGCTG
CGCCATTTATTGCTGTTGAGATGGCCCGAGCATTGGTTGAAGACATGCTCAATGCAGCTAGAAGTACCTC
CGGTGTGGAAGATCATGCCTATGCGAAGTTATTAACGGAAGACCTTGAACGTGCACGTCGCCAAATCAAT
GAGGAGTACGCTGCGTTGCAGCGAAGATACGGCTCAGAGCAAGAATTGCTGGCGCATTTTAACCAGGTGA
TACAGACCATTCGCAAACAGCGTTATTACACCGTTAAATCTACGGCACTGGGGGAATAG
 Primer design