SecReT4
Protein ID: 120597998
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1175
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1325797..1329366 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDA1RH73
KEGG IDshw:Sputw3181_1175
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4e-102, Aligned region: 3..462
Protein Sequence: 1189 a.a.     [Download]
>gi|120597998|ref|YP_962572.1| TraG domain-containing protein [Shewanella sp. W3-18-1]
MWEIYSIGDSAFLEQVLNAVAMITGTGDFTSMVRIGLLIGVLMVSVQALMQGGRGINFQHVLVSWLVFAT
MFGPSTRVSIEDAYTGQVRVVDNVPIGVAAAGSTISTVGFQITRLFETAFSTPAMTEYGFASSLQSLIKV
RKQVMDRSGLGDANRVGGSDIEQSWFNYIKECTLIGIDIGQKNLDQVLSDPNPMTAIRFDSRIYGTRIML
SGSSSDLDCTDAYSQLKLMTESTFIPRLKQVLSASLGTSSATDTDDVIRNALNNLGLALVNTQEYMTASV
LLPIYEQSVTGKYMDDQAFTAAVMVNQAIEQRNTQWAAEQTLFQSIVRPMMTFFEGFIYAITPLMAFVIA
LGQIGMRMAGKYLLILLWIQLWMPVMAIINLYIHLTVAGKMSALDAFAGTEVPSFAGLMQMDSVLQTWIA
TGGMLASSVPAISLMLVYGSAITATHLAGRLQNGDAIDEKMASPDVAKNAPVMQSQSMFQNSALTGSAMT
GASNLLSSFSVGNAVGSMVGSAKESMTQATQAFSRQVGNTMSRTFGEKLSYDNLSSVGRQIGSSNSASSA
VVNQVTDDLQTRYGFGDDKKDAVRGLVSGVLSGGLRVGGDGTITNPGEKEVADKGFLGRLLGTGGNDSPQ
GNLPGMDKPDSSRVPKLSRVRAGLDLGGNFSGQVESSEGSSRSTTANTLTGEMQSLASSDSRRAEFRDAM
VKDLSDSRRSGVEMSLSNQDYQSLQSSAQDVITASNRFSELDQASYSLSGQRNTDGATLTRLAADNPEVM
DYLGRYMNQHVEAGNRLRENLPMYQRLLPDDNQAYVAAAMESLTYSNSSTPAERDNDYQAAMTVMAMATG
ADLRSIQPRSNEGLSSTAPTFGGTQSQVESGVLGGYEGAARVQTQFNSAQSAYQTNLSGVDGQLNAHQQQ
AQQAVASDTSTYQSGLNSEAGSQWRSRIMADDSGVSGAEMFFNSASAIGDFSGKHTDAALHTLNHFGEDY
ESYKEQALEDPGSRGFLHNATVASKSTWDGLKAAVDAGTSLENPLTAFNDAYSGSSSQYASEVNWGTKSE
AMLAGAFGAAVNNRYGEFLEQYADDFKQEAYSEGQRMGLTPIQSQVFAQAFNEGLAGRVFNSEDSSSWSP
EMLGLREQMLNEYRQKDESGAYIPDSVSEEDKAFVDKQIAVISNASLAGDYAQNNLIDIRAYNQASGRN
 
Nucleotide Sequence: 3570 bp     [Download]
>gi|120596833|ref|NC_008750.1|:1325797-1329366 Shewanella sp. W3-18-1 chromosome, complete genome
ATGTGGGAGATCTATTCCATCGGGGATTCGGCATTTTTAGAGCAGGTCTTGAACGCTGTCGCGATGATTA
CTGGTACAGGCGACTTTACTTCAATGGTTCGCATTGGCTTGCTCATTGGGGTATTGATGGTCTCTGTTCA
GGCCTTAATGCAAGGCGGTCGTGGCATTAACTTTCAACACGTTTTAGTCTCATGGCTAGTCTTTGCAACC
ATGTTTGGACCCAGTACCCGAGTGAGCATTGAGGATGCGTACACGGGACAAGTTCGAGTGGTTGATAATG
TGCCCATCGGTGTTGCTGCCGCAGGCAGTACGATTTCAACTGTCGGCTTTCAAATCACGCGATTGTTTGA
AACGGCGTTCTCAACTCCCGCCATGACGGAATACGGCTTTGCATCCAGTTTACAGTCACTGATTAAAGTG
AGAAAACAGGTGATGGATCGCTCGGGGTTGGGTGATGCAAATCGTGTCGGTGGCTCAGATATCGAGCAAT
CGTGGTTTAACTACATCAAAGAATGCACCTTGATTGGCATCGACATCGGCCAAAAGAACCTAGATCAGGT
GCTGAGTGATCCTAACCCGATGACTGCGATTAGGTTTGATTCGCGCATATATGGCACACGCATCATGCTA
AGTGGTAGCAGTAGCGATCTGGACTGCACCGATGCCTATAGCCAACTGAAACTCATGACAGAATCAACCT
TCATTCCGAGGCTTAAACAGGTTCTGTCAGCCTCATTGGGGACTTCGTCAGCAACGGATACTGATGACGT
GATCCGAAATGCACTGAATAACCTTGGTTTGGCTTTGGTTAACACCCAAGAGTACATGACCGCGTCAGTG
CTTTTGCCTATTTATGAGCAAAGCGTGACGGGCAAGTATATGGATGATCAAGCTTTCACCGCCGCCGTTA
TGGTTAATCAAGCGATTGAACAGCGCAATACACAATGGGCGGCGGAGCAGACTCTTTTCCAAAGTATCGT
TCGTCCGATGATGACGTTTTTTGAGGGTTTCATTTACGCCATCACCCCTTTGATGGCCTTTGTGATAGCC
CTAGGCCAAATCGGGATGCGAATGGCTGGGAAGTACTTGTTAATCCTGCTTTGGATTCAACTTTGGATGC
CTGTCATGGCTATCATTAACCTGTATATTCATTTAACCGTTGCAGGGAAAATGTCGGCTCTTGATGCCTT
TGCAGGTACAGAAGTGCCATCTTTTGCTGGGTTGATGCAGATGGATTCAGTGCTGCAAACCTGGATAGCT
ACTGGCGGCATGTTGGCGTCGAGTGTTCCGGCAATTTCGCTCATGCTCGTGTATGGCTCAGCAATAACTG
CAACCCACTTGGCTGGACGTCTTCAAAACGGTGATGCCATTGATGAAAAGATGGCAAGTCCAGATGTCGC
GAAAAATGCCCCGGTGATGCAATCACAGTCAATGTTCCAAAATTCAGCCCTCACTGGTTCTGCTATGACC
GGCGCGTCAAACCTACTTAGCAGTTTCTCTGTCGGAAATGCGGTGGGTTCAATGGTCGGCTCTGCAAAAG
AATCCATGACTCAGGCAACTCAAGCCTTTAGCCGTCAAGTTGGCAATACCATGAGCCGAACTTTTGGTGA
AAAGCTAAGTTACGACAATCTATCTTCAGTTGGACGTCAAATCGGTTCTTCTAATTCCGCATCTAGCGCC
GTTGTTAATCAGGTTACTGATGACCTACAAACTCGGTATGGTTTCGGAGACGATAAAAAAGATGCTGTAC
GTGGCTTGGTATCTGGCGTGTTATCGGGAGGCCTAAGGGTCGGTGGCGATGGAACTATTACTAATCCCGG
TGAGAAAGAAGTTGCTGATAAGGGTTTTCTTGGAAGGCTTCTTGGTACGGGCGGCAATGATTCTCCACAG
GGCAACTTGCCAGGAATGGATAAGCCAGATTCATCTCGTGTACCAAAACTATCAAGGGTACGAGCTGGGT
TGGATCTAGGTGGTAACTTTAGTGGCCAAGTTGAGTCGTCAGAAGGCAGTTCTCGGTCTACGACCGCAAA
TACGCTCACTGGGGAGATGCAAAGCTTGGCATCGAGTGATTCACGACGTGCTGAGTTTCGCGATGCGATG
GTTAAGGACCTTTCAGATTCAAGACGCTCTGGCGTTGAGATGTCGTTGTCTAATCAAGACTATCAGTCAC
TTCAGAGTTCAGCACAAGACGTTATCACGGCATCAAACCGCTTTAGTGAGCTTGATCAGGCCAGCTACAG
TCTATCAGGACAAAGGAACACGGATGGTGCGACGTTAACTCGATTAGCAGCGGATAATCCTGAAGTCATG
GATTATTTAGGTCGCTATATGAACCAGCATGTTGAAGCAGGTAACCGATTACGTGAAAACCTTCCAATGT
ATCAGCGCTTGCTACCTGATGATAATCAGGCGTATGTGGCCGCAGCTATGGAGTCTTTAACCTATAGCAA
CTCCTCGACGCCCGCTGAACGAGACAATGACTATCAAGCAGCAATGACTGTTATGGCCATGGCTACCGGA
GCCGATTTACGATCAATTCAGCCACGCTCTAATGAAGGCTTGTCATCAACGGCACCTACTTTTGGTGGCA
CTCAAAGCCAAGTTGAATCCGGTGTTCTGGGAGGCTATGAGGGTGCTGCAAGAGTTCAAACGCAGTTCAA
TTCGGCTCAATCTGCTTACCAAACCAATCTTTCTGGTGTAGATGGACAGCTGAATGCGCATCAGCAACAA
GCCCAGCAGGCCGTAGCTTCTGACACAAGTACCTATCAATCTGGACTAAACAGTGAAGCTGGCTCTCAGT
GGCGATCTCGCATTATGGCTGATGATAGCGGAGTCTCTGGTGCTGAAATGTTCTTCAACAGCGCCAGTGC
TATTGGTGATTTCAGTGGCAAGCATACTGATGCAGCTCTGCATACCTTGAATCACTTTGGCGAAGACTAT
GAGAGTTACAAAGAACAAGCGCTTGAAGATCCTGGCTCACGAGGTTTCTTGCACAACGCAACGGTGGCCA
GCAAATCAACCTGGGATGGGTTAAAAGCCGCCGTTGATGCCGGAACCTCTTTGGAAAATCCATTGACGGC
GTTTAATGATGCATACAGTGGATCGAGTTCGCAGTATGCCTCCGAAGTAAACTGGGGCACTAAGTCTGAA
GCCATGTTGGCGGGGGCATTTGGTGCGGCAGTTAACAATCGATATGGTGAGTTCTTAGAACAGTATGCCG
ATGATTTCAAACAGGAAGCATACAGCGAAGGGCAGAGAATGGGATTGACCCCGATTCAAAGTCAAGTGTT
CGCTCAAGCTTTCAATGAAGGTTTGGCGGGACGCGTATTCAACTCTGAAGACTCATCGAGTTGGTCGCCT
GAAATGCTAGGTCTAAGGGAGCAAATGCTAAATGAGTATCGTCAAAAGGATGAGAGTGGCGCTTACATCC
CTGACAGTGTGTCCGAAGAAGATAAAGCATTTGTGGATAAGCAGATAGCGGTGATCTCAAATGCATCGCT
AGCGGGAGATTATGCTCAGAACAACTTGATCGATATTAGGGCTTATAACCAGGCATCAGGAAGGAACTGA
 Primer design