SecReT4
Protein ID: 120598002
T4SS name [ID]Tra_F [588]
Gene symbol-
Locus tagSputw3181_1179
StrainShewanella sp. W3-18-1
Repliconchromosome [GenBank: NC_008750] [Browse all T4SS(s) in this replicon]
Location [Strand]1330714..1331262 [-]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA1RH77
KEGG IDshw:Sputw3181_1179
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|120598002|ref|YP_962576.1| lytic transglycosylase, catalytic [Shewanella sp. W3-18-1]
MKTIKAKTVALVIAMSASTSVYAFPGYQWEKAAQSVGIDPVMLYAVALAESASHRGLNMTSPWPYAIRNG
SNATYAKSKTEAEQLLNQALQESEKYQLDIGLMQINLHWHGHRVSSAAELLDPITNLTVGSSILAEAIKS
SPNDLELGIGRYHSWNEERARWYGQRVLSIYRNILHELEVRQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|120596833|ref|NC_008750.1|:c1331262-1330714 Shewanella sp. W3-18-1 chromosome, complete genome
ATGAAAACGATTAAAGCAAAAACCGTTGCCCTAGTGATAGCCATGTCCGCAAGCACTTCAGTCTATGCGT
TTCCGGGCTATCAGTGGGAAAAAGCAGCACAAAGTGTTGGTATTGATCCAGTCATGCTCTACGCCGTTGC
CTTGGCTGAGTCCGCCTCACATCGAGGTCTTAACATGACCAGTCCATGGCCATACGCAATTCGCAATGGT
TCAAACGCAACCTACGCCAAATCTAAGACAGAAGCGGAGCAACTGTTAAACCAGGCACTTCAAGAGAGTG
AAAAATACCAGCTCGATATTGGCCTTATGCAAATCAATTTGCATTGGCATGGGCATCGAGTGAGCTCAGC
AGCCGAACTGCTAGACCCCATCACCAACCTTACTGTCGGCTCCAGTATTTTGGCCGAAGCAATCAAGTCT
TCACCAAACGATTTAGAGCTTGGCATAGGCCGCTATCACAGTTGGAACGAAGAGCGTGCACGCTGGTATG
GGCAAAGAGTGCTTTCTATCTATCGCAATATTTTACATGAACTGGAGGTCCGTCAATGA
 Primer design