SecReT4
Protein ID: 120609191
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0489
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]527741..529141 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1TJF7
KEGG IDaav:Aave_0489
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 466 a.a.     [Download]
>gi|120609191|ref|YP_968869.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MDDMASPRFAPRAGLRSLIAIAALAALCSTSGAQTRIDEDGIRANGNVIGSDVLYSIGGGRAVSMSPAGN
MQSIGVGMGWNSNLICGDMSITTTLQNQLNGISNGFQSIMTNVIQSATSAVASLPALIIQRADPGLYNLL
TNGILQARLDFDRSKMTCRAIASRMADMAGGQTGWDQLAEGMALKQAVSSTDAVSAIERAEANKGNNGVP
WVGGSSAGGSGQSSIKIVGDVTRAGYNLLNGRGATDTSSISASDCNGRLSCQTWSSPQAAATWATRVLGE
REQRTCETCTKTSTTPGVGLTPLIQEEYEAKLKALQELVSGAKPTTAANLDAAGSASLPLTRGVIEALRD
EPDQDLLGKRLASEVALASVMEKALLLQRTLLTGRKEPNVAANELATKAVDQESGALEQEIQNLKTELEL
RRELAGNSPMTLIQRYSTRAAGSRGIYQGDPTRDRVQEIQKPRSTQ
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c529141-527741 Acidovorax citrulli AAC00-1 chromosome, complete genome
GTGGACGACATGGCATCCCCTCGCTTTGCTCCCCGCGCAGGCCTGCGCAGCCTGATCGCCATCGCCGCAC
TCGCCGCCCTCTGCAGCACCTCCGGTGCGCAGACGCGGATCGACGAGGACGGCATCCGCGCCAACGGCAA
CGTGATCGGTAGCGACGTGCTCTACAGCATCGGCGGCGGCCGCGCCGTGTCGATGAGCCCCGCGGGAAAC
ATGCAGAGCATCGGCGTCGGCATGGGCTGGAACAGCAACCTGATCTGCGGGGACATGAGCATCACGACCA
CGCTGCAGAACCAGCTCAACGGCATCAGCAACGGGTTCCAGTCGATCATGACCAACGTGATCCAGTCCGC
GACGAGCGCGGTCGCATCGCTGCCAGCGCTCATCATCCAGCGTGCCGATCCCGGGCTCTACAACCTGCTG
ACGAACGGCATCCTCCAGGCCCGGCTGGACTTCGACCGCTCCAAGATGACGTGCCGCGCGATAGCGAGCC
GCATGGCCGACATGGCGGGCGGGCAGACCGGCTGGGACCAGCTGGCCGAGGGCATGGCCCTCAAGCAGGC
GGTATCCAGCACCGACGCGGTATCAGCCATCGAACGCGCCGAGGCCAACAAGGGCAACAACGGCGTTCCC
TGGGTCGGCGGGAGCAGCGCGGGCGGCTCGGGCCAGTCCTCGATCAAGATCGTGGGGGACGTCACGCGTG
CGGGCTACAACCTGTTGAACGGGCGCGGCGCCACCGACACGTCTTCCATCTCGGCCAGCGACTGCAATGG
GCGCCTGTCGTGCCAGACGTGGAGCTCGCCCCAGGCCGCGGCCACGTGGGCAACGAGGGTGCTGGGCGAG
CGGGAGCAACGGACCTGCGAGACCTGCACGAAGACCTCGACGACACCGGGCGTGGGCCTGACACCGCTGA
TCCAGGAAGAGTACGAGGCCAAGCTCAAAGCATTGCAGGAACTCGTGTCCGGGGCCAAGCCGACCACCGC
GGCAAACCTGGACGCCGCCGGCAGCGCTTCGCTGCCGCTCACGCGGGGCGTCATCGAAGCGCTACGCGAC
GAGCCCGACCAGGACCTGCTGGGCAAGCGCCTGGCGTCTGAGGTCGCGCTCGCCTCGGTGATGGAGAAGG
CCCTTCTGCTGCAGCGCACGCTGCTGACGGGCAGGAAGGAACCCAACGTCGCGGCCAACGAACTCGCGAC
GAAGGCCGTGGACCAGGAGAGCGGCGCACTGGAACAGGAGATCCAGAACCTGAAGACCGAGCTCGAACTG
CGCCGCGAACTCGCCGGCAACTCGCCGATGACGCTGATCCAGCGCTACAGCACGCGCGCTGCCGGCTCGC
GCGGCATCTACCAGGGGGATCCAACCCGGGACCGTGTCCAGGAGATTCAGAAACCGCGGAGCACGCAATG
A
 Primer design