SecReT4
Protein ID: 120609192
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0490
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]529162..530091 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDA1TJF8
KEGG IDaav:Aave_0490
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.6e-92, Aligned region: 28..298
Protein Sequence: 309 a.a.     [Download]
>gi|120609192|ref|YP_968870.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MRSKRLRAATFGVLLAATLPTYALDTATIVASAFSPDCFAYRVSGICYWLYCTWSGCTVRTSVKVRHYVP
DAVVSSYSNTGANPWVEVRAMSVPNPTAQAGGDGTTNQSHENNLAKFKNADVIGHPAGEAFSAFASASGY
TCEGAGTPFMPYLLSTFDTLAWRYNVPELAYPESLTPGMREIGSRLSVDLWGNVYPRGGFLHQTDDYFSG
AVVAQRAGDVVTRTGQPHVYQPLLASPRAGYWPAGPLVESNPDSGKWQELTPTLSSQCAVFPNRGPHVQA
QQGDYAWALWRPYSCCQRRGQVFLGSTDF
 
Nucleotide Sequence: 930 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c530091-529162 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCGCTCCAAGAGACTGCGCGCCGCAACCTTCGGCGTTCTTCTCGCCGCCACGCTGCCGACGTATGCGC
TGGATACCGCGACCATCGTGGCTTCGGCGTTTTCACCCGACTGCTTCGCGTATCGCGTCTCCGGCATTTG
CTACTGGCTGTATTGCACCTGGAGCGGCTGCACGGTACGCACCTCGGTGAAGGTGCGGCACTACGTTCCC
GACGCGGTCGTCTCCAGCTACAGCAACACGGGGGCGAACCCCTGGGTCGAAGTCCGCGCGATGAGCGTGC
CCAACCCCACCGCGCAGGCCGGGGGCGACGGAACCACCAACCAGAGCCACGAAAACAACCTCGCGAAGTT
CAAAAACGCGGACGTGATCGGACACCCGGCCGGTGAAGCGTTCTCCGCGTTCGCCAGCGCTTCCGGCTAC
ACCTGCGAGGGCGCAGGCACGCCCTTCATGCCGTACCTGCTGAGCACCTTCGACACGCTGGCATGGCGCT
ACAACGTGCCCGAGCTCGCGTACCCCGAATCGCTCACGCCCGGTATGCGCGAGATCGGATCTCGGCTATC
GGTGGACCTGTGGGGCAACGTCTATCCGCGCGGCGGCTTCCTGCACCAGACCGACGACTACTTCAGTGGC
GCCGTGGTCGCACAGCGCGCTGGCGATGTGGTGACACGCACCGGCCAGCCGCACGTGTACCAGCCCCTGC
TCGCGAGCCCGCGCGCGGGCTACTGGCCCGCCGGCCCGCTGGTCGAGAGCAATCCGGATTCCGGCAAGTG
GCAGGAGCTGACGCCCACCCTGTCCAGCCAATGCGCGGTTTTCCCCAACCGCGGCCCCCACGTGCAAGCC
CAGCAGGGTGACTACGCCTGGGCGCTCTGGCGCCCGTACAGCTGCTGCCAGCGGCGCGGCCAGGTCTTCC
TCGGCAGCACCGACTTCTGA
 Primer design