SecReT4
Protein ID: 120609204
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0502
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]545993..548929 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDA1TJH0
KEGG IDaav:Aave_0502
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.2e-70, Aligned region: 83..357
AAA_10 [PF12846], Evalue: 5.3e-46, Aligned region: 551..889
FtsK_SpoIIIE [PF01580], Evalue: 2.2e-05, Aligned region: 548..581
Protein Sequence: 978 a.a.     [Download]
>gi|120609204|ref|YP_968882.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MPRHPHWRWSERAAGALHRLRSGVAAMGSAAPDHPGAEPPDAWDTHIARLAENGIPPPGAHVRPSGAPPA
TEDDERALYGVSPSFVDMLPWAEYLPESRCMLLDDGVSVAAFFELVPIGTEGREMAWLWQARDALENALQ
DAFDELDDHPWVVQLYAQDEASWDRYLRGLDAYVQPRARDTAFTTFYQRFFAHHLRAIAKPGGLFEDTAV
TRLPWRGQARRVRMVVYRRLGDAASQRRGLSPEQALATICDRLQGGLANAGVRAERLGAADIHAWLLRWF
NPQPRLLGDTALDRERFYDLTRYPDEAEEGDIELASGTDFTQRLFFGPPRSDVDNGLWWFDGMPHRAVVM
DRLRNAPGTGHLTGETRKGDAINALFDQVPEDTVMCLTLVATPQDVLESHLNHLARKAVGETLASEQTRR
DVQEARGLIGSAHKLYRGALAFYLRGQDLAQLDERGVQLANVMLGAGLQPVREDDEVAPLNTYLRWLPCV
FDAAKDTRQWYTQLMFVQHAANLAPVWGRSRGTGHPGITLFNRGGDTITFDPLNRLDRQMNAHLFLFGPT
GSGKSATLNNLLNQVTAMYRPRLFIVEAGNSFGLFGDFAARLGLTVNRVRLAPGAGVSLAPFADARRLVD
TPSQVRTLDADALDEGPDAGGTASDGDEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDA
ARRCTAAGRTVLTRDVRDALRERAGDANLPDMRRARLLEMADAMDMFCQGADGEMFDRAGTPWPEADITI
VDLATYAREGYNAQLSVAYISLINTVNNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKL
GAWFWLGTQNLDDLPKAAEPMLNMIEWWICLSMPPDEVEKIARFRELNAAQKALMLSARKEAGKFTEGVI
LSKSMELLFRAVPPSLYLAMAMTEPEEKAERFALMQQHGINELDAAILVAERIDRARGIEPLPHHALG
 
Nucleotide Sequence: 2937 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c548929-545993 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCCGCGGCATCCGCACTGGCGCTGGTCCGAGCGCGCGGCAGGTGCGCTGCACCGGCTGCGCAGCGGTG
TCGCCGCGATGGGCTCCGCCGCTCCGGACCATCCGGGCGCGGAACCGCCGGATGCGTGGGACACGCACAT
CGCCCGGCTCGCCGAGAACGGCATTCCACCGCCGGGCGCCCACGTCCGCCCGTCCGGCGCGCCGCCCGCC
ACCGAAGACGACGAGCGCGCCCTCTACGGCGTGTCGCCCTCGTTTGTGGACATGCTGCCCTGGGCCGAAT
ACCTGCCGGAGTCGCGGTGCATGCTGCTGGACGACGGCGTGTCCGTCGCGGCGTTCTTCGAGCTCGTGCC
CATCGGCACCGAAGGCCGCGAGATGGCGTGGCTGTGGCAGGCCCGCGATGCGCTGGAGAACGCGCTGCAG
GACGCTTTCGACGAGTTGGACGACCACCCCTGGGTGGTGCAGCTTTATGCCCAGGACGAGGCCAGTTGGG
ACCGCTACCTGCGCGGCCTGGACGCCTACGTGCAGCCGCGCGCGCGGGACACCGCCTTCACCACTTTCTA
CCAACGCTTCTTCGCCCACCACCTGCGCGCCATCGCCAAGCCCGGCGGCCTGTTCGAGGACACCGCCGTG
ACGCGCCTGCCCTGGCGCGGCCAGGCCCGCCGCGTGCGGATGGTGGTCTACCGGCGCCTCGGCGATGCCG
CCAGCCAGCGCCGCGGCCTGTCGCCCGAACAGGCGCTCGCCACTATCTGCGACCGCCTGCAGGGCGGCCT
GGCCAACGCGGGCGTGAGGGCGGAACGCCTGGGCGCCGCCGATATTCATGCCTGGCTCCTGCGCTGGTTC
AATCCCCAGCCGCGGCTGCTCGGCGATACCGCGCTGGACCGGGAACGCTTCTACGACCTGACGCGCTATC
CCGACGAAGCGGAGGAAGGCGACATCGAACTCGCGAGCGGCACCGACTTCACGCAGCGCCTGTTCTTCGG
CCCACCGCGCTCCGACGTGGACAACGGCCTCTGGTGGTTCGACGGCATGCCCCACCGTGCGGTGGTGATG
GACCGCCTGCGCAACGCGCCGGGCACGGGTCACCTCACGGGCGAGACGCGCAAGGGCGACGCGATCAACG
CGCTTTTCGATCAGGTACCCGAGGACACCGTGATGTGCCTCACCCTGGTCGCCACGCCGCAGGACGTGCT
CGAATCCCACTTGAACCACCTCGCGCGCAAGGCCGTGGGTGAGACGCTGGCCTCCGAGCAGACGCGCCGC
GACGTGCAGGAGGCGCGTGGCCTCATCGGCAGCGCGCACAAGCTCTACCGGGGCGCTCTCGCCTTCTACC
TGCGCGGGCAGGATCTCGCGCAGCTGGACGAACGCGGCGTGCAGCTTGCCAACGTGATGCTGGGCGCCGG
CCTTCAGCCGGTGCGCGAGGACGACGAGGTCGCCCCCCTCAACACCTACCTGCGATGGCTGCCCTGCGTG
TTCGACGCGGCGAAGGACACACGGCAGTGGTACACGCAACTGATGTTCGTGCAGCACGCGGCCAACCTCG
CGCCCGTCTGGGGGCGCAGCCGCGGCACGGGGCACCCCGGCATCACGCTGTTCAACCGCGGCGGCGACAC
CATCACCTTCGATCCGCTCAACCGGCTGGACCGGCAGATGAACGCCCATCTGTTCCTGTTCGGGCCCACG
GGGTCGGGCAAGAGCGCCACCCTCAACAACCTGCTCAACCAGGTGACGGCGATGTACCGCCCTCGCCTCT
TCATCGTCGAGGCGGGCAACTCGTTCGGGCTGTTCGGCGACTTCGCCGCCCGCCTGGGCCTCACCGTGAA
CCGCGTGCGGCTCGCCCCGGGCGCGGGTGTGAGCCTCGCACCCTTCGCCGATGCGCGGCGCCTGGTGGAC
ACGCCCAGCCAGGTCCGCACGCTCGACGCCGATGCCCTCGATGAAGGGCCAGATGCCGGCGGCACCGCTT
CCGACGGGGACGAGCAGCGCGACGTGCTCGGCGAACTGGAGATCACCGCCCGCCTCATGATTACCGGCGG
AGAGGACAAGGAAGAGGCGCGCATGACGCGCGCCGACCGCAGTCTGATCCGCCAGTGCATCCTCGATGCC
GCCCGCCGCTGCACGGCCGCGGGCCGCACCGTGCTGACGCGGGACGTGCGCGACGCGCTGCGCGAACGGG
CGGGCGACGCCAACCTGCCCGATATGCGCCGCGCCCGGCTGCTGGAAATGGCGGATGCCATGGACATGTT
CTGCCAGGGCGCGGACGGAGAGATGTTCGACCGCGCCGGCACGCCCTGGCCCGAGGCCGACATCACCATC
GTGGACCTCGCCACCTACGCGCGCGAGGGCTATAACGCCCAGCTCTCGGTGGCGTACATCTCGCTCATAA
ATACCGTCAACAACATCGCGGAGCGCGACCAGTTCCTCGGCCGGCCCATCATCAACGTCACCGACGAGGG
CCACATCATCACCAAGAATCCGCTGCTCGCGCCCTACGTCGTGAAGATCACGAAGATGTGGCGCAAGCTC
GGCGCCTGGTTTTGGCTCGGGACACAAAACCTGGACGACCTGCCGAAGGCGGCCGAGCCGATGCTGAACA
TGATCGAGTGGTGGATCTGCCTGTCCATGCCGCCCGACGAGGTGGAGAAGATCGCCCGCTTCCGCGAGCT
CAACGCCGCGCAGAAAGCGCTGATGCTCTCGGCCCGCAAGGAGGCGGGCAAGTTCACTGAGGGCGTGATC
CTCTCCAAGTCCATGGAGCTGCTTTTCCGGGCGGTGCCGCCCAGCCTGTACCTGGCCATGGCCATGACCG
AACCCGAAGAGAAAGCCGAACGCTTTGCTTTGATGCAGCAGCACGGCATCAACGAGCTCGACGCCGCCAT
CCTGGTCGCCGAGCGCATCGATCGCGCACGCGGCATCGAGCCGCTGCCGCACCACGCCCTGGGCTGA
 Primer design