SecReT4
Protein ID: 120609205
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0503
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]548929..549393 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDA1TJH1
KEGG IDaav:Aave_0503
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 154 a.a.     [Download]
>gi|120609205|ref|YP_968883.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MRSTWTERRMPRRHLLATIALLLSGCATHKDDLLSHGDRTMRDIWDQETGGAGAPGAQGGGAAARQLLDA
RQVLRRPLTAADFQAIPGQNAAYTRTAQNEIYRQFRRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQ
RVQYAMPGERVEDY
 
Nucleotide Sequence: 465 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c549393-548929 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCGATCGACCTGGACTGAGCGCCGCATGCCGCGGCGCCACCTGCTCGCCACCATCGCCTTGCTGCTGT
CGGGCTGCGCAACGCACAAGGACGACCTGCTGTCGCACGGCGACCGGACGATGCGGGACATCTGGGATCA
GGAGACCGGCGGCGCCGGGGCGCCTGGCGCGCAGGGCGGCGGCGCGGCCGCACGCCAGTTGCTCGACGCG
CGGCAAGTCCTGCGCCGTCCCCTGACGGCGGCCGACTTCCAGGCGATTCCCGGCCAGAACGCGGCCTACA
CCCGCACCGCGCAGAACGAGATCTACCGCCAGTTCCGCCGGCTGCCCAACCCCGACCTGGTGATGTACGT
CTTCCCCCACCTGGCCGGCACCGACCCCGTGCCGGTACCGGGATACAGCACGGTGTTCCCGCTGTACCAG
CGCGTGCAGTACGCGATGCCTGGCGAGCGCGTGGAGGACTACTGA
 Primer design