SecReT4
Protein ID: 120609206
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0504
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]549374..550849 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDA1TJH2
KEGG IDaav:Aave_0504
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 491 a.a.     [Download]
>gi|120609206|ref|YP_968884.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MKSNGLLKWLMIPVIALLVFLGIHLTSGRSDKSAAGGGTAQLTPEEMKALGIDGDTPRDTVATLVAQVKQ
LRGELQTAVGDNKNQRAENERLRQRDSSIDQRIQAAIDGERNRQRQENDQAAGDKQQTQSMLQDLQHKLD
QLGAKGGSADLPVGLGLEEGDGKGFGTSGASGVRWVEPDDARPDAGKTAPGGPGKADRFPMRFGPADGGT
GGGSASATPAGTSPATEAKPAKPVYTLPTNATLMGSVAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTAN
GIDLPEVAGAVVSGTASGDWTLSCVRGQIRSITFVFRDGTIRTVPDDKAQGGAGGSRGGSGNGNAADGQG
PILGGLGWISDPHGIPCVGGERRSNAQQYLGSQALITAAGAGAASLIKSDSGSVAVVSNGNGSLGTVGIS
GNEAMGRILAGGVQEMSQWVNKLYGQAFAAVYVPPGAQVAVHLEQPLQIDYEAQGRKVRHTTGGIHAIDL
D
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c550849-549374 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAAAAGTAACGGCCTGCTCAAGTGGCTGATGATCCCGGTGATCGCGCTGCTGGTCTTCCTCGGCATCC
ATCTCACGTCCGGGCGCTCGGACAAGTCCGCCGCAGGAGGCGGCACCGCGCAGCTCACGCCCGAGGAAAT
GAAGGCCCTGGGCATCGACGGCGACACGCCGCGCGACACCGTGGCCACCCTGGTCGCGCAGGTCAAGCAA
CTGCGCGGCGAACTGCAGACCGCCGTCGGCGACAACAAGAACCAGCGCGCGGAAAACGAGCGGCTTCGCC
AGCGCGATAGCTCCATCGACCAGCGCATCCAGGCCGCGATCGACGGTGAGCGCAACCGCCAGCGCCAGGA
GAATGACCAAGCCGCCGGCGACAAGCAGCAGACCCAGAGCATGCTGCAGGACCTGCAGCACAAGCTGGAC
CAGTTGGGCGCCAAGGGCGGCTCCGCCGACCTGCCGGTCGGGCTCGGTCTGGAGGAAGGCGACGGCAAGG
GCTTCGGCACCTCCGGCGCTTCTGGCGTGCGGTGGGTGGAACCCGACGACGCGCGGCCCGACGCGGGCAA
GACCGCGCCCGGCGGCCCGGGCAAGGCCGATCGCTTTCCGATGCGCTTCGGCCCCGCCGATGGCGGTACG
GGCGGCGGCTCCGCATCCGCCACGCCGGCCGGCACCTCGCCCGCCACCGAGGCCAAGCCCGCCAAGCCCG
TCTACACCCTGCCCACCAACGCCACCCTGATGGGTTCCGTCGCGATGACGGCCCTGATCGGTCGTGTGCC
GATCGACGGCACGGTCAACGACCCCTATCCCTTCAAGGTGCTCATCGGCCCCGACAACCTCACGGCCAAC
GGGATCGACCTGCCGGAGGTGGCGGGCGCCGTGGTGAGCGGCACCGCATCCGGTGACTGGACGCTCTCCT
GCGTGCGCGGCCAGATCCGCTCGATCACCTTCGTGTTTCGCGACGGCACCATCCGCACGGTCCCGGACGA
CAAGGCCCAGGGCGGCGCCGGCGGCAGCCGCGGCGGCTCTGGCAACGGCAATGCCGCCGACGGCCAGGGC
CCCATCCTGGGCGGCCTGGGCTGGATCAGCGATCCGCACGGCATCCCCTGTGTCGGCGGCGAGCGGCGCA
GCAACGCGCAGCAGTACCTCGGATCGCAGGCCCTCATCACTGCCGCTGGCGCCGGCGCGGCGTCGCTCAT
CAAGAGCGACAGCGGCAGCGTGGCGGTGGTCAGCAACGGCAACGGCTCGCTCGGCACCGTGGGCATCTCG
GGCAACGAGGCCATGGGCCGCATCCTCGCCGGCGGCGTGCAGGAGATGTCCCAGTGGGTGAACAAGCTCT
ACGGCCAGGCTTTCGCGGCGGTGTACGTGCCACCCGGCGCGCAGGTCGCCGTCCACCTCGAACAACCCCT
GCAGATCGACTACGAAGCCCAGGGCCGCAAGGTCCGCCACACCACCGGAGGAATCCATGCGATCGACCTG
GACTGA
 Primer design