SecReT4
Protein ID: 120609207
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0505
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]550839..551834 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDA1TJH3
KEGG IDaav:Aave_0505
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.9e-123, Aligned region: 10..300
Protein Sequence: 331 a.a.     [Download]
>gi|120609207|ref|YP_968885.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTRPISFALRALALGATLWLGGAPAAHALQILRWERMPMAVPLRVGEERVVFIDRNVRVGVPAAIADRLR
VQSAGGAIYLRASEAIEPTRLQLQDADSGALILIDIAAEAPKEGQGPLEPVRIIEGDTPGPRYGARDASA
DTDAGSGEQSAETHASGPTEPGARARHETPVAVVLTRYAAQSLYAPLRTVEPARGVSQANLRRGLNLDAL
APSLPVRAQALAAWRMEDQWVTAVRLTNTSPRWVDLDPRLLIGDFVAATFQHPGLGPAGDATDTTVLYLV
TRGRGLGDALLPRISRIDAAQNLPPPAADAAAVTEATPATPRQPSGADHEK
 
Nucleotide Sequence: 996 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c551834-550839 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACCCGACCCATCTCCTTCGCCCTGCGCGCGCTCGCGCTGGGCGCCACGCTCTGGCTGGGCGGCGCGC
CAGCGGCCCATGCACTGCAGATCCTGCGCTGGGAACGCATGCCCATGGCGGTGCCCTTGCGCGTCGGGGA
AGAGCGCGTGGTCTTCATCGATCGGAACGTGCGCGTGGGGGTGCCCGCCGCCATCGCCGATCGGCTGCGC
GTGCAGAGCGCGGGCGGCGCGATCTACCTGCGCGCGAGCGAGGCGATCGAGCCGACCCGGTTGCAGTTGC
AGGACGCCGACAGCGGCGCGCTGATCCTGATCGACATCGCTGCCGAAGCGCCCAAGGAAGGCCAGGGGCC
GCTGGAGCCGGTGCGCATCATCGAGGGCGACACGCCGGGCCCGCGCTACGGCGCGCGCGATGCGAGCGCG
GACACCGATGCGGGCAGCGGCGAACAGTCCGCCGAAACGCATGCGTCCGGCCCCACCGAGCCGGGTGCGC
GCGCGCGCCACGAGACCCCGGTGGCCGTGGTGCTCACCCGCTACGCCGCACAGAGCCTCTACGCTCCCTT
GCGCACGGTGGAACCTGCGCGGGGCGTGTCACAGGCGAACCTGCGCCGCGGCCTGAACCTGGACGCTCTC
GCGCCGTCGCTGCCCGTGCGGGCGCAGGCCCTGGCCGCCTGGCGCATGGAAGACCAGTGGGTGACCGCGG
TCCGCCTGACCAACACCTCGCCGCGCTGGGTGGACCTCGATCCCCGCTTGCTGATCGGCGACTTCGTCGC
CGCGACCTTCCAGCACCCGGGCCTGGGGCCGGCCGGCGACGCCACGGATACCACGGTGCTCTACCTCGTC
ACGCGCGGCCGCGGGCTGGGCGACGCGCTGCTGCCGCGCATCAGCCGCATCGACGCCGCACAGAACCTGC
CGCCGCCCGCAGCCGACGCTGCCGCAGTCACGGAGGCCACGCCGGCCACCCCGCGCCAGCCTTCGGGAGC
AGACCATGAAAAGTAA
 Primer design