SecReT4
Protein ID: 120609208
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0506
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]551831..552532 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDA1TJH4
KEGG IDaav:Aave_0506
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 5.5e-93, Aligned region: 5..206
Protein Sequence: 233 a.a.     [Download]
>gi|120609208|ref|YP_968886.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSRFRNEVAHLQAHVSTLRRVGAALFALAVLLGIGWANAPRHLTIHVPPDLRSGSTRKWWDVPPENVYAF
GYYIFQQLNRWPTNGEEDYPRNLRALSAYLTPSCQALLQQDYETRRNNGELRQRVRGLYEIPGRSYGEDP
TTRVKVLSERDWIVTLDVAADEYYAGEQVKRALVRYPLKVVRLDIDPERNPFGLALDCYSGTPQRITPPA
PPPAATTPGSPSAPAAPLPGSTP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c552532-551831 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCCGCTTTCGCAACGAGGTGGCGCACCTGCAGGCGCACGTGAGCACCCTGCGCCGGGTGGGCGCCG
CACTGTTCGCGCTGGCAGTGCTGTTGGGCATCGGCTGGGCGAATGCGCCGCGCCACCTGACCATCCACGT
GCCGCCCGACCTGCGCTCGGGCAGCACCCGCAAGTGGTGGGACGTTCCGCCCGAGAACGTGTACGCCTTC
GGCTACTACATCTTCCAGCAGCTCAACCGCTGGCCGACGAATGGCGAGGAGGACTACCCCCGCAACCTGC
GCGCCCTGTCCGCCTACCTCACCCCATCCTGCCAGGCCCTGCTGCAGCAGGACTACGAGACCCGCCGCAA
CAACGGCGAACTGCGCCAGCGCGTGCGCGGCCTTTACGAAATCCCGGGCCGCAGCTATGGCGAAGACCCA
ACTACGCGCGTCAAGGTGCTGTCTGAGCGCGACTGGATCGTGACGCTCGACGTCGCCGCGGACGAGTACT
ACGCGGGAGAGCAGGTCAAGCGGGCGCTTGTGCGCTACCCGCTGAAGGTAGTCCGCCTCGACATCGATCC
CGAGCGCAACCCGTTCGGCCTGGCCCTCGACTGCTACAGCGGTACCCCGCAGCGCATCACGCCGCCCGCC
CCGCCGCCCGCGGCCACGACACCGGGTTCCCCGTCCGCGCCCGCCGCGCCCTTGCCTGGAAGCACGCCAT
GA
 Primer design