SecReT4
Protein ID: 120609209
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0507
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]552529..552987 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA1TJH5
KEGG IDaav:Aave_0507
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.4e-48, Aligned region: 10..132
Protein Sequence: 152 a.a.     [Download]
>gi|120609209|ref|YP_968887.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MAPQDTTRDGLVAFLPHRLNRQPVVVRGLTADELWVCAGASAAAGLAAGLPLAWITRSIAMVPTMIVAGI
AAGVFIGGGILRRAKRGRPDTWLYRQLQWRLALRHPLWAARLGGHGLVTRSGCWTTRRTVPVRRLRGRRG
FHPHHANPRGRP
 
Nucleotide Sequence: 459 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c552987-552529 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGCCCCCCAGGACACGACACGCGACGGCCTCGTCGCCTTCCTGCCGCACCGGCTGAACCGCCAGCCCG
TGGTGGTGCGCGGACTCACCGCCGACGAACTCTGGGTCTGCGCCGGCGCATCGGCCGCCGCCGGCCTGGC
CGCAGGGCTGCCGTTGGCGTGGATCACGCGCAGCATCGCCATGGTCCCCACTATGATCGTGGCGGGCATT
GCCGCGGGCGTGTTCATTGGAGGCGGCATCCTGCGGCGCGCGAAGCGCGGCCGGCCCGACACCTGGCTGT
ACCGCCAGCTGCAGTGGCGGCTGGCCCTGCGCCATCCGCTGTGGGCCGCACGCCTCGGCGGCCATGGGCT
GGTCACGCGCTCGGGCTGCTGGACCACGCGCCGCACAGTGCCCGTTCGCCGCCTGCGCGGCCGCCGCGGC
TTCCACCCACACCACGCGAATCCCCGGGGCCGGCCATGA
 Primer design