SecReT4
Protein ID: 120609212
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0510
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]553638..554015 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA1TJH8
KEGG IDaav:Aave_0510
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.2e-28, Aligned region: 32..110
Protein Sequence: 125 a.a.     [Download]
>gi|120609212|ref|YP_968890.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTSRATASHAASPRLPLSGVLAVALLCGATSASADTALERERLAGAQRLLDQADRLAATAAPAAASEPSR
YHFDYARLHDDVRRMQTGFASYLIPVRAQPRDPSALAGQYTRENAPGPAPAEQRR
 
Nucleotide Sequence: 378 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c554015-553638 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACCTCGCGTGCCACGGCCAGCCACGCCGCATCCCCTCGCCTCCCCCTGTCCGGCGTGCTGGCCGTGG
CACTCCTTTGTGGCGCGACGTCCGCCAGCGCCGACACCGCCCTCGAACGCGAGCGGCTGGCGGGGGCGCA
GCGCCTGCTCGATCAGGCCGACCGGCTCGCCGCCACGGCGGCTCCCGCAGCGGCTTCCGAGCCCTCCCGG
TACCACTTCGACTACGCGCGCCTGCACGACGACGTGCGCCGCATGCAGACGGGCTTCGCCAGCTACCTGA
TCCCGGTGCGCGCGCAGCCGCGCGATCCGTCCGCGCTGGCGGGCCAGTACACGCGCGAGAACGCGCCGGG
GCCGGCGCCTGCGGAGCAGCGCCGATGA
 Primer design