SecReT4
Protein ID: 120609227
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0526
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]569843..570592 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1TJJ3
KEGG IDaav:Aave_0526
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.2e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|120609227|ref|YP_968905.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSDVAATAQRQQVRQQGFIVALITLPFRCFGVLCGSLLLCIVVECVGMALFWPDQGWRHAQAMLSHELDQ
LSDYFVRSALVQEPGRTAHHWVQQGYEWVFVRSGLLEWMRDASRQARANAAGHAWSLQKVLGSVATHTQD
YLIAAGYTVLVFMVRLLVLCLSLPLFILAAFAGFVDGLVRRDIRRFGAGRESGFLYHRARASLVPLAVLP
WVIYLALPVSVHPVAILLPAAVLLGIATDVAAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c570592-569843 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCGATGTCGCCGCCACCGCCCAGCGCCAGCAGGTACGCCAGCAGGGCTTCATCGTCGCCCTCATTA
CGCTGCCGTTCCGCTGCTTCGGCGTGCTGTGCGGATCGCTCCTGCTGTGCATCGTGGTCGAATGCGTGGG
CATGGCGCTGTTCTGGCCGGACCAGGGATGGCGCCACGCACAGGCCATGCTGAGCCATGAGCTGGACCAG
CTGTCCGACTACTTCGTGCGCAGCGCGCTCGTGCAGGAGCCCGGGCGTACCGCGCACCACTGGGTGCAGC
AAGGCTACGAGTGGGTGTTCGTGCGCAGCGGCCTGCTCGAATGGATGCGGGACGCCTCGCGCCAGGCCCG
CGCGAACGCGGCCGGCCACGCATGGAGCCTGCAGAAGGTGCTGGGCAGCGTGGCCACACACACGCAGGAC
TACCTGATCGCCGCGGGCTACACCGTGCTGGTGTTCATGGTGCGCCTGCTCGTGCTGTGCCTGTCGCTGC
CGCTCTTCATCCTGGCGGCATTCGCCGGGTTCGTGGACGGGCTGGTGCGCAGGGACATCCGGCGGTTCGG
CGCGGGGCGCGAGTCGGGGTTTCTGTACCACCGCGCACGGGCCAGCCTAGTGCCGCTGGCGGTGCTGCCC
TGGGTGATCTACCTGGCCCTGCCGGTGAGCGTGCATCCGGTGGCGATCCTGCTGCCGGCGGCGGTGCTGC
TGGGGATCGCGACGGATGTCGCAGCTGGGAGCTTCAAGAAGTATCTCTGA
 Primer design