SecReT4
Protein ID: 120609228
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0527
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]570589..572781 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDA1TJJ4
KEGG IDaav:Aave_0527
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 7.5e-16, Aligned region: 507..637
TrwB_AAD_bind [PF10412], Evalue: 1.7e-09, Aligned region: 508..647
AAA_10 [PF12846], Evalue: 1.4e-08, Aligned region: 190..584
Protein Sequence: 730 a.a.     [Download]
>gi|120609228|ref|YP_968906.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MAQAHAVEVLLRPAVELYTVAVCAGAALACVVAPWSLALSPTLGFASALGFAAFGGIRLQQAHAILRYRR
NIRRLPRYVMTSRDVPVSQQRLFLGRGFRWDQRHTHRLMQTYRPEFRRYVEPTALYRLARRCEERLEFAP
PPFARLARWTAWDHPMNPVRPLPPVGGLPRLHGIEPQEVDVTLPLGERVGHTLVLGTTRVGKTRLAELFI
TQDIRRRAADGGYEVVIVFDPKGDADLLKRMYVEARRAGREGEFYVFHLGWPDLSARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFMEYAAHFFARTQPKA
WEIIVQLEARLNDKNIPRNMIGREKRVIAIEQYLAQVRVYDPVLDGLRSAVRYDRTYFDKIVASLLPLLE
KLTTGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
FGVDDGLPGADASSKVPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYTQTLSDIEARIGNRAKAGQV
VGNFNNLVMLRVRETATAELLTRQLPKVEVFATSVTSGATDSSDPTGNTAFTSNTQDRVASTSVPLIEPA
HVVALPKGQAFALLEGGNLWKVRMPLPAPDPDEAMPRDLQELAAGMRLHYVMDAGSWWDGQGAAGPRDDG
LPDDLLQGAFATTEADDPADQGGMDGAGMP
 
Nucleotide Sequence: 2193 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c572781-570589 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGCCCAGGCGCATGCAGTCGAGGTGCTGCTGCGCCCCGCGGTGGAGCTATACACCGTTGCGGTTTGCG
CCGGCGCCGCGCTGGCGTGCGTGGTGGCACCGTGGTCGCTCGCGCTGAGCCCCACTCTGGGGTTTGCCAG
CGCCCTCGGTTTCGCGGCCTTCGGCGGCATCCGCCTGCAGCAGGCCCACGCCATCCTGCGCTACCGACGC
AACATCCGCCGCCTGCCGCGCTACGTGATGACCAGCCGCGACGTCCCGGTCAGCCAGCAGCGCCTGTTCC
TCGGCCGCGGCTTTCGCTGGGACCAGCGCCACACGCACCGGCTGATGCAGACCTACCGGCCCGAGTTCCG
CCGCTACGTCGAGCCGACCGCGCTCTACCGGCTCGCGCGGCGGTGCGAGGAGCGCCTGGAGTTCGCGCCG
CCACCGTTCGCGCGCCTGGCGCGCTGGACGGCGTGGGACCATCCGATGAACCCCGTGCGGCCCCTGCCGC
CGGTCGGCGGGCTGCCGCGCCTGCACGGCATCGAGCCGCAGGAGGTGGATGTCACCCTGCCGCTGGGGGA
GCGGGTCGGGCATACCCTGGTGCTGGGCACCACGCGCGTCGGCAAGACGCGCCTGGCCGAACTGTTCATC
ACGCAGGACATCCGCCGCCGCGCGGCCGACGGTGGGTACGAAGTGGTGATCGTCTTCGACCCCAAGGGCG
ACGCGGACCTGCTCAAGCGCATGTACGTGGAGGCGCGCCGCGCCGGACGCGAAGGCGAGTTCTATGTGTT
CCACCTGGGCTGGCCCGACCTGAGCGCGCGCTACAACGCGGTGGGGCGCTTCGGCCGCATCTCGGAAGTC
GCCACGCGCATCGCGGGGCAGTTGTCCGGCGAGGGCAACAGCGCGGCCTTCCGCGAATTCGCGTGGCGGT
TCGTCAACATCATCGCGCGGGCACTCGTGGAACTGGGTCAGCGCCCGGACTACCTGCTGATCCAGCGCCA
CGTCATCAACATCGATGCGCTGTTCATGGAGTACGCCGCGCACTTCTTCGCGCGCACGCAGCCCAAGGCC
TGGGAGATCATCGTCCAGCTCGAAGCGCGCCTCAACGACAAGAACATCCCGCGCAACATGATCGGGCGCG
AGAAGCGTGTGATCGCAATCGAGCAGTACCTCGCGCAGGTGCGCGTGTACGACCCCGTTCTCGACGGGCT
GCGCAGCGCGGTGCGCTACGACCGGACCTACTTCGACAAGATCGTCGCCAGCCTGCTGCCGCTGCTGGAG
AAGCTCACCACGGGCAAGATCGCCCAACTGCTGGCACCCAACTATTCGGACCTGGCCGACCCACGGCCCA
TCTTCGACTGGATGCAGGTCATCCGAAAGCGCGCGATCGTGTATGTAGGCCTGGACGCGCTCTCGGATGC
GGAAGTGGCGGCCGCCGTGGGCAATTCCATGTTCTCGGACCTGGTGTCGGTCGCCGGCCACATCTACAAG
TTCGGCGTGGACGACGGGCTGCCCGGCGCCGACGCCAGCAGCAAGGTGCCGATCAACGTCCACGCCGACG
AGTTCAACGAGCTGATGGGCGACGAGTTCATTCCCATGGTCAACAAGGGCGGCGGTGCCGGTGTGCAGGT
CACGGCGTACACGCAGACGCTCTCCGACATCGAGGCGCGCATCGGCAACCGCGCCAAGGCCGGCCAGGTG
GTGGGCAACTTCAACAACTTGGTCATGCTGCGCGTCAGGGAGACGGCCACGGCCGAACTGCTCACCCGCC
AGTTGCCCAAGGTCGAGGTCTTCGCCACCTCCGTGACCAGCGGTGCCACCGACAGTTCCGATCCCACGGG
CAACACCGCATTCACCTCCAATACTCAGGACCGCGTCGCCAGCACCAGCGTACCGCTTATCGAGCCCGCG
CACGTCGTCGCCCTGCCCAAGGGCCAGGCCTTCGCGCTGCTCGAAGGGGGCAACCTGTGGAAGGTGCGCA
TGCCACTGCCCGCACCCGACCCCGACGAGGCCATGCCGCGCGACCTGCAGGAGCTGGCCGCCGGCATGCG
ACTGCACTACGTCATGGACGCTGGAAGCTGGTGGGACGGCCAGGGCGCCGCAGGACCTCGGGATGACGGA
TTGCCCGACGACCTGCTGCAGGGCGCGTTCGCCACTACCGAGGCAGACGACCCCGCCGACCAGGGCGGGA
TGGATGGGGCCGGCATGCCATGA
 Primer design