SecReT4
Protein ID: 120609229
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0528
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]572783..573367 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDA1TJJ5
KEGG IDaav:Aave_0528
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.5e-49, Aligned region: 45..193
Protein Sequence: 194 a.a.     [Download]
>gi|120609229|ref|YP_968907.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MKLPALRLRPCAPLWLLALVCLPSLGLGAEPAKSAPSPRPGLIVIEDRGGVSAQPYYDELGLPPLRASGA
PSTGGAAKSTAPVVPVEAVGLPVRSTLLSPGVVEARPLQAPGLPPFFLVGDDARSRAWLQQRAGALRQLR
AAGLVVNVESPQALQELRALAPGLVLSPASGDDLARRLGLRHYPALLTATGIEQ
 
Nucleotide Sequence: 585 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c573367-572783 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAAGCTCCCCGCATTGCGACTCCGCCCGTGCGCGCCTCTGTGGCTGCTCGCGCTGGTTTGCCTGCCGT
CCTTGGGCCTGGGTGCGGAACCCGCGAAATCCGCACCGTCGCCCCGCCCCGGCCTGATCGTCATCGAGGA
CCGGGGAGGCGTATCGGCGCAGCCCTACTACGACGAGCTCGGGCTTCCCCCGTTGCGAGCGAGCGGCGCC
CCTTCGACCGGCGGGGCAGCCAAGTCCACGGCGCCCGTCGTCCCGGTCGAGGCGGTGGGCCTGCCAGTAC
GCTCAACCCTGCTGTCCCCTGGAGTCGTGGAAGCTCGCCCGCTGCAGGCGCCGGGGTTGCCCCCCTTTTT
CCTGGTCGGTGACGACGCGCGCTCCAGGGCCTGGCTGCAGCAGCGAGCCGGCGCGCTGCGCCAGTTGCGC
GCCGCGGGCCTCGTCGTGAATGTCGAGTCGCCGCAAGCGCTGCAGGAACTGCGCGCCCTGGCGCCGGGTC
TGGTGCTCTCGCCGGCCTCGGGGGACGATCTGGCCCGCAGGCTGGGGCTTCGCCACTACCCGGCCCTGTT
GACCGCCACGGGCATCGAGCAGTGA
 Primer design