SecReT4
Protein ID: 120609230
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0529
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]573364..573972 [-]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDA1TJJ6
KEGG IDaav:Aave_0529
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 202 a.a.     [Download]
>gi|120609230|ref|YP_968908.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MAATVIPQRCTTVLRWAIALGTAACSAVPALAQELPPPAYQIAAAQSGVPSSVLYAVALQESGTRLRGRL
VPWPWTLNVAGTPQRHATRADACLALRSALRDTPAERIDVGLGQVNAGYHAHRVQRPCALLDPYRNLGIA
AEILHEQYRPGEDWLAAVGRYHRPAGGPPAARYRGAVQRHLVRLLGNPQAMASLHPRRETTP
 
Nucleotide Sequence: 609 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c573972-573364 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGCAGCGACAGTGATTCCTCAGCGCTGCACCACGGTCCTTCGATGGGCGATCGCACTGGGCACGGCCG
CATGCAGCGCCGTGCCCGCCCTCGCCCAGGAGCTTCCCCCGCCCGCCTACCAGATCGCCGCGGCGCAATC
GGGCGTGCCCTCGTCCGTGCTGTACGCGGTCGCGCTGCAGGAGAGCGGAACCCGGCTGCGCGGCCGGCTG
GTTCCCTGGCCGTGGACGCTCAACGTCGCCGGCACGCCGCAGCGGCACGCCACGCGCGCTGACGCCTGCC
TTGCGCTGCGCAGCGCACTGCGGGACACCCCCGCCGAACGCATCGACGTCGGGCTCGGCCAGGTCAATGC
GGGCTACCACGCGCACCGCGTGCAGCGACCCTGCGCGCTGCTGGACCCCTACCGCAACCTCGGTATCGCC
GCAGAAATCCTGCATGAGCAGTACCGGCCCGGCGAAGACTGGCTGGCCGCGGTGGGCCGCTACCACCGCC
CCGCAGGCGGCCCGCCCGCAGCGCGCTACCGCGGCGCCGTGCAGCGCCACCTCGTGCGCTTGCTGGGCAA
CCCGCAGGCGATGGCCTCACTGCATCCGCGTCGAGAGACCACCCCATGA
 Primer design