SecReT4
Protein ID: 120609231
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0530
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]573957..574715 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDA1TJJ7
KEGG IDaav:Aave_0530
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|120609231|ref|YP_968909.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MRAESPSAIAVFIAVSLCALGLGAPNVAQAQAQAARVGETRTTASAARPLADAHDDEARAREWGLRAEDW
SRYRTLMQGPLGIYSPNLDPLTALGIEARSDEERRRYAELQVQAEARRVQKTLDYQRAYDAAWQRLYPDQ
QRVALQAGPAAGSSGTAEPGRLALFVKEDCAACDQRVQQLQSAGTPVDVYLIGSRGDDERIRRWARRAGV
DPAKVRARTITLNHDGGRWLSLGASGDLPAVMREVGGQWQRQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c574715-573957 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCGAGCGGAAAGCCCTTCAGCCATCGCGGTATTCATTGCGGTAAGCCTGTGCGCCCTTGGCCTGGGTG
CGCCCAACGTGGCGCAGGCGCAGGCGCAAGCAGCGCGCGTCGGCGAGACCCGCACCACGGCAAGCGCAGC
ACGGCCGTTGGCCGATGCGCACGACGACGAGGCCCGGGCCCGCGAATGGGGCCTGCGCGCGGAGGACTGG
TCGCGCTACCGGACGTTGATGCAGGGGCCTCTCGGCATCTACTCCCCCAACCTCGATCCGCTGACGGCAC
TCGGCATCGAGGCACGCAGTGACGAGGAGCGGCGACGATACGCGGAGCTCCAGGTGCAGGCCGAGGCCCG
CCGCGTGCAAAAAACCCTGGACTACCAGCGTGCATACGACGCGGCATGGCAGCGGCTGTACCCCGACCAG
CAGCGCGTGGCACTGCAGGCCGGCCCGGCGGCCGGCAGCAGCGGTACCGCGGAACCGGGACGCTTGGCCC
TGTTCGTGAAGGAGGATTGCGCCGCGTGCGACCAGCGCGTGCAGCAGCTCCAGTCCGCCGGCACACCGGT
GGACGTGTACCTGATCGGAAGCCGCGGCGACGACGAGCGCATCCGCCGGTGGGCGCGGCGAGCGGGCGTC
GATCCCGCCAAGGTGCGGGCGCGGACGATCACGCTCAACCACGATGGCGGCCGCTGGCTGTCGCTCGGCG
CGTCCGGCGATCTTCCGGCGGTCATGCGCGAGGTGGGTGGCCAATGGCAGCGACAGTGA
 Primer design