SecReT4
Protein ID: 120609233
T4SS name [ID]Tfc [727]
Gene symbol-
Locus tagAave_0532
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]575379..575948 [-]
ProductPilL protein
Component typeTfc2
UniProt IDA1TJJ9
KEGG IDaav:Aave_0532
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|120609233|ref|YP_968911.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MQPHPSPAPRRWGFAPVAAAVASVLLGGCASAPPAYEAAAPSPAPTASAPAGIDADRPSPVPVTRQGRYT
LVELGAEAGQRDLLMQVINVTQPSAEGSTVQDGLQYLLRQSGYRLCPPDADSSTLYALPLPAAHVRLGPI
TLRDALQTMAGDAWALSVDDTTRLVCFHRSGASAAAIEPAWLPKEKQPW
 
Nucleotide Sequence: 570 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c575948-575379 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCAGCCACACCCCTCACCCGCCCCCCGCCGCTGGGGATTCGCCCCGGTGGCCGCCGCGGTCGCATCAG
TCCTCCTGGGCGGATGCGCAAGCGCACCACCTGCCTACGAGGCCGCCGCCCCCAGTCCAGCGCCCACGGC
GTCCGCACCCGCCGGGATTGACGCGGACCGGCCTTCGCCAGTTCCGGTCACACGGCAGGGCCGCTACACC
CTGGTCGAGCTCGGCGCCGAGGCTGGTCAGCGCGATCTGTTGATGCAGGTCATAAACGTCACGCAGCCAT
CGGCCGAAGGGTCCACGGTCCAGGACGGCCTGCAGTACCTGCTGCGGCAGTCGGGCTACCGGCTGTGCCC
GCCCGACGCGGACAGCAGCACCCTGTATGCCCTGCCGCTGCCCGCGGCACATGTGCGTCTCGGCCCCATC
ACGCTGCGCGACGCGCTCCAGACGATGGCCGGCGACGCCTGGGCGCTCTCGGTGGACGACACGACGCGCT
TGGTCTGCTTTCACCGCTCCGGCGCCAGCGCCGCGGCGATCGAGCCGGCCTGGCTTCCGAAGGAGAAACA
GCCATGGTGA
 Primer design