SecReT4
Protein ID: 120609387
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0690
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]749121..749732 [+]
Productputative conjugal transfer TRAF transmembrane protein
Component typeTraF
UniProt IDA1TK03
KEGG IDaav:Aave_0690
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 7.7e-53, Aligned region: 54..198
Protein Sequence: 203 a.a.     [Download]
>gi|120609387|ref|YP_969065.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MTAPTTTASTPAVAPRPRSHPRSRLRARIVVATLAAIGFAALAWAAFVSLLPRLTYNPSDSVVVGWYRID
PFDPRTASLPRPLSVDSIVLVPLPATAAALAAQRGYLPTRVPLLKRVGAVAPQHVCIVAGQVRIDGVPSA
AVLPADRLGRPLPSLQLCRRLEPGELFLLSVTNPASFDSRYFGPVSASAVIGMARPIWLETHP
 
Nucleotide Sequence: 612 bp     [Download]
>gi|120608714|ref|NC_008752.1|:749121-749732 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGACCGCCCCGACCACCACGGCCAGCACGCCCGCCGTTGCGCCCCGTCCTCGCTCGCACCCGCGTTCAC
GTTTGCGCGCTCGCATCGTCGTGGCGACACTGGCTGCCATCGGCTTCGCTGCGCTGGCCTGGGCGGCTTT
CGTGTCGCTGCTGCCGCGTCTGACCTACAACCCGTCTGACAGCGTGGTGGTCGGCTGGTATCGCATCGAC
CCGTTCGACCCGCGCACCGCCTCGCTGCCACGTCCCTTGTCCGTGGACAGCATCGTGCTGGTGCCGTTGC
CAGCCACGGCCGCTGCGCTCGCTGCGCAGCGCGGCTACCTGCCGACGCGCGTTCCGCTGCTCAAACGTGT
GGGCGCGGTCGCGCCGCAACACGTCTGCATCGTCGCCGGTCAGGTACGCATCGATGGCGTGCCTTCGGCC
GCCGTGCTGCCCGCCGACCGGCTGGGCCGGCCGCTGCCGTCCCTGCAGCTTTGCCGCCGTCTCGAACCGG
GCGAGCTGTTCCTGTTGAGCGTGACCAATCCGGCATCGTTCGACAGCCGCTACTTCGGTCCGGTCAGCGC
ATCCGCCGTGATCGGCATGGCGCGCCCGATCTGGCTGGAGACACACCCATGA
 Primer design