SecReT4
Protein ID: 120609420
T4SS name [ID]Trb [257]
Gene symbol-
Locus tagAave_0724
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T4SS(s) in this replicon]
Location [Strand]777866..779872 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA1TK36
KEGG IDaav:Aave_0724
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.2e-105, Aligned region: 112..562
TraG-D_C [PF12696], Evalue: 2.6e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 6e-31, Aligned region: 172..539
Protein Sequence: 668 a.a.     [Download]
>gi|120609420|ref|YP_969098.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MQAQGVLFGQIAAVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDLYGTPVYYPWKLFEWWFFFDAYAPQ
VFDTGGMIAASSGLLAVAVAIAMSVWRSRQARKVTTYGSARWADAADIRKAGLTQPAGVFLGQHYGHYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDASSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
SPFELTLHRMMTTKHLGDAQHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRIAPWLGHLMVSRQETARPLLTPGEVMQLPTDEAVVMVSSVAPIKAKKLRYFADANFKQRVIPPPA
VTAGRYADVPPARPDDWSGLAIPAVPAAPATASADDLEALGSTDDGGPRRQPELSEAIAYAPAMDAPASD
LSLLDDDDMPPVLPGQLDPALQRTSRLASLNPNDGIDL
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|120608714|ref|NC_008752.1|:777866-779872 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCAGGCTCAAGGTGTGTTGTTCGGGCAGATCGCCGCCGTCTTCGGCATCGTGATCGCCGGTGTGTGGG
GTGCCACGCAATGGACAGCCGCCGCCTTGGGCTACCAGCTACGCCTGGGCTCGCCCTGGTTCGACTTGTA
CGGCACACCGGTCTATTACCCTTGGAAGCTGTTCGAGTGGTGGTTCTTCTTCGACGCCTACGCGCCGCAG
GTGTTCGACACCGGCGGCATGATCGCGGCAAGCAGTGGCCTGTTGGCCGTGGCGGTCGCCATCGCCATGT
CGGTGTGGCGCTCGCGCCAGGCGCGCAAGGTGACGACCTATGGCTCGGCCCGCTGGGCCGATGCCGCCGA
CATTCGCAAGGCTGGGCTGACGCAGCCCGCTGGTGTCTTTCTCGGACAGCATTACGGCCACTACCTGCGG
CACGAAGGGCCGGAACACGTCCTGACCTTTGCGCCGACGCGCTCAGGCAAGGGTGTGGGCCTGGTGGTGC
CGACATTGTTGAGTTGGCCCGCGTCCGCCGTCATCCACGACATCAAAGGCGAGAACTGGCAGATCACAGC
CGGCTGGCGCTCGCGCTTCTCGCACTGCCTGCTGTTCAACCCCACCGATGCCAGTTCGGCGGCCTACAAC
CCGCTGCTGGAGGTACGGCGCGGCGCGCATGAGGTGCGCGACGTGCAGAACATCGCCGACATCCTGGTCG
ATCCAGAAGGCGCGCTGGAGAAGCGCAACCATTGGGAGAAGACCAGTCACGCGCTACTGGTCGGCGCGAT
CCTGCATGTGCTGTACGCGGGGGAAGACAAGACGCTGCGTGGCGTCGCCAACTTCCTGTCCGATCCGGCC
AGCCCGTTCGAGCTGACCTTGCACCGAATGATGACGACCAAACACCTGGGCGATGCCCAGCATCCCGTCG
TTGCATCCGCTGCCCGCGAAGTGCTCAACAAGTCGGACAACGAGCGGTCTGGCGTGCTCTCCACCGCCAT
GTCGTTCCTCGGTCTGTACCGTGATCCGACCGTGGCCGAAGTCACTTCGCGCTGCGACTGGCGCATCGCT
GACCTGATCGCAGCAGAGCATCCGGTATCGCTCTATCTGGTGGTGCCGCCTTCCGACATTTCGCGCACCA
AGCCGCTGATCCGGCTGATCCTCAACCAGATCGGCCGGCGGCTCACCGAATCGCTCGACGGCTCCGACGG
TATCGAGCGCCGGCACAAGCTGCTGCTGATGCTCGATGAGTTCCCGGCGCTTGGCCGTCTGGACTTCTTC
GAGACGGCGCTGGCCTTCATGGCGGGTTACGGCATCCGCAGCTTCCTCATCGCGCAATCGCTCAATCAAA
TCGACAAGGCCTACGGCCAGAACCATTCGATTCTGGACAACTGCCATGTGCGTGTGACGTTCGCCACCAA
CGACGAACGCACGGCCAAACGCATTTCAGAAACCCTCGGCACGGCCACTGAGCTGCGTGCGCAGCGCAAC
TACGCGGGCCACCGGATCGCGCCGTGGCTGGGCCACCTGATGGTGTCGCGCCAAGAAACCGCACGGCCGC
TGCTGACGCCGGGTGAAGTGATGCAGCTACCGACCGATGAGGCGGTGGTGATGGTGTCCAGTGTCGCGCC
GATCAAGGCGAAGAAGCTGCGCTACTTCGCCGACGCCAATTTCAAGCAACGGGTGATTCCGCCGCCTGCG
GTGACGGCAGGCCGCTATGCCGATGTGCCGCCTGCACGACCTGACGACTGGAGCGGCCTGGCAATACCTG
CGGTTCCTGCGGCACCGGCCACGGCATCCGCCGATGACCTGGAGGCCTTGGGTTCGACCGACGACGGCGG
CCCACGCCGCCAGCCCGAACTGTCCGAAGCCATCGCCTATGCCCCAGCGATGGATGCCCCGGCCAGCGAC
CTGTCGCTGCTCGATGACGACGACATGCCCCCGGTGCTTCCCGGCCAGCTAGACCCCGCCCTGCAACGCA
CGTCGCGGCTGGCATCGCTGAACCCCAACGACGGAATCGACCTATGA
 Primer design